Cargando…
Transcriptome analysis revealed the possible regulatory pathways initiating female geese broodiness within the hypothalamic-pituitary-gonadal axis
Geese have the strongest tendency toward broodiness among all poultry. The mechanisms initiating broodiness within the goose hypothalamic-pituitary-gonadal axis (HPGA) are still unclear. Here, we reported the transcriptome differences between laying and initial nesting within the HPGA tissues of gee...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5800542/ https://www.ncbi.nlm.nih.gov/pubmed/29408859 http://dx.doi.org/10.1371/journal.pone.0191213 |
_version_ | 1783298216424374272 |
---|---|
author | Liu, Hehe Wang, Jiwen Li, Liang Han, Chunchun He, Hua Xu, Hengyong |
author_facet | Liu, Hehe Wang, Jiwen Li, Liang Han, Chunchun He, Hua Xu, Hengyong |
author_sort | Liu, Hehe |
collection | PubMed |
description | Geese have the strongest tendency toward broodiness among all poultry. The mechanisms initiating broodiness within the goose hypothalamic-pituitary-gonadal axis (HPGA) are still unclear. Here, we reported the transcriptome differences between laying and initial nesting within the HPGA tissues of geese. We constructed a unigene database based on HPGA tissues and identified 128,148 unigenes, 100% of which have been annotated. By using Digital Gene Expression (DGE) sequencing, we screened 19, 110, 289, and 211 differentially expressed genes (DEGs) in the hypothalamus, pituitary gland, stroma ovarii, and follicles, respectively, between laying and nesting geese. Expression changes of hypocretin (HCRT) and pro-opiomelanocortin (POMC) in the hypothalamus of nesting geese may cause appetite reduction, which is possibly the first step and a prerequisite to initiate broodiness. In addition to prolactin (PRL), follicle-stimulating hormone (FSH) and luteinizing hormone (LH), genes including oxytocin-neurophysin (OXT), chordin-like protein 1 (CHRDL1) and growth hormone (GH), expressed in the pituitary gland, are new candidate molecules that may be involved in broodiness in geese. Heme oxygenase 1 (HMOX1) in the pituitary gland, the proto-oncogene c-Fos (FOS), heat shock protein 90-alpha (HSP90AA), and cyclin-dependent kinase 1 (CDK1) in the ovary that may consolidate and transduce signals regulating the HPGA during broodiness in geese. |
format | Online Article Text |
id | pubmed-5800542 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-58005422018-02-23 Transcriptome analysis revealed the possible regulatory pathways initiating female geese broodiness within the hypothalamic-pituitary-gonadal axis Liu, Hehe Wang, Jiwen Li, Liang Han, Chunchun He, Hua Xu, Hengyong PLoS One Research Article Geese have the strongest tendency toward broodiness among all poultry. The mechanisms initiating broodiness within the goose hypothalamic-pituitary-gonadal axis (HPGA) are still unclear. Here, we reported the transcriptome differences between laying and initial nesting within the HPGA tissues of geese. We constructed a unigene database based on HPGA tissues and identified 128,148 unigenes, 100% of which have been annotated. By using Digital Gene Expression (DGE) sequencing, we screened 19, 110, 289, and 211 differentially expressed genes (DEGs) in the hypothalamus, pituitary gland, stroma ovarii, and follicles, respectively, between laying and nesting geese. Expression changes of hypocretin (HCRT) and pro-opiomelanocortin (POMC) in the hypothalamus of nesting geese may cause appetite reduction, which is possibly the first step and a prerequisite to initiate broodiness. In addition to prolactin (PRL), follicle-stimulating hormone (FSH) and luteinizing hormone (LH), genes including oxytocin-neurophysin (OXT), chordin-like protein 1 (CHRDL1) and growth hormone (GH), expressed in the pituitary gland, are new candidate molecules that may be involved in broodiness in geese. Heme oxygenase 1 (HMOX1) in the pituitary gland, the proto-oncogene c-Fos (FOS), heat shock protein 90-alpha (HSP90AA), and cyclin-dependent kinase 1 (CDK1) in the ovary that may consolidate and transduce signals regulating the HPGA during broodiness in geese. Public Library of Science 2018-02-06 /pmc/articles/PMC5800542/ /pubmed/29408859 http://dx.doi.org/10.1371/journal.pone.0191213 Text en © 2018 Liu et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Article Liu, Hehe Wang, Jiwen Li, Liang Han, Chunchun He, Hua Xu, Hengyong Transcriptome analysis revealed the possible regulatory pathways initiating female geese broodiness within the hypothalamic-pituitary-gonadal axis |
title | Transcriptome analysis revealed the possible regulatory pathways initiating female geese broodiness within the hypothalamic-pituitary-gonadal axis |
title_full | Transcriptome analysis revealed the possible regulatory pathways initiating female geese broodiness within the hypothalamic-pituitary-gonadal axis |
title_fullStr | Transcriptome analysis revealed the possible regulatory pathways initiating female geese broodiness within the hypothalamic-pituitary-gonadal axis |
title_full_unstemmed | Transcriptome analysis revealed the possible regulatory pathways initiating female geese broodiness within the hypothalamic-pituitary-gonadal axis |
title_short | Transcriptome analysis revealed the possible regulatory pathways initiating female geese broodiness within the hypothalamic-pituitary-gonadal axis |
title_sort | transcriptome analysis revealed the possible regulatory pathways initiating female geese broodiness within the hypothalamic-pituitary-gonadal axis |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5800542/ https://www.ncbi.nlm.nih.gov/pubmed/29408859 http://dx.doi.org/10.1371/journal.pone.0191213 |
work_keys_str_mv | AT liuhehe transcriptomeanalysisrevealedthepossibleregulatorypathwaysinitiatingfemalegeesebroodinesswithinthehypothalamicpituitarygonadalaxis AT wangjiwen transcriptomeanalysisrevealedthepossibleregulatorypathwaysinitiatingfemalegeesebroodinesswithinthehypothalamicpituitarygonadalaxis AT liliang transcriptomeanalysisrevealedthepossibleregulatorypathwaysinitiatingfemalegeesebroodinesswithinthehypothalamicpituitarygonadalaxis AT hanchunchun transcriptomeanalysisrevealedthepossibleregulatorypathwaysinitiatingfemalegeesebroodinesswithinthehypothalamicpituitarygonadalaxis AT hehua transcriptomeanalysisrevealedthepossibleregulatorypathwaysinitiatingfemalegeesebroodinesswithinthehypothalamicpituitarygonadalaxis AT xuhengyong transcriptomeanalysisrevealedthepossibleregulatorypathwaysinitiatingfemalegeesebroodinesswithinthehypothalamicpituitarygonadalaxis |