Cargando…
Transcriptome of Porcine PBMCs over Two Generations Reveals Key Genes and Pathways Associated with Variable Antibody Responses post PRRSV Vaccination
Porcine reproductive and respiratory syndrome virus (PRRSV) is a virus susceptible to antibody dependent enhancement, causing reproductive failures in sows and preweaning mortality of piglets. Modified-live virus (MLV) vaccines are used to control PRRS in swine herds. However, immunized sows and pig...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5802836/ https://www.ncbi.nlm.nih.gov/pubmed/29410429 http://dx.doi.org/10.1038/s41598-018-20701-w |
_version_ | 1783298599279394816 |
---|---|
author | Yang, Ting Zhang, Fengxia Zhai, Liwei He, Weiyong Tan, Zhen Sun, Yangyang Wang, Yuan Liu, Lei Ning, Chao Zhou, Weiliang Ao, Hong Wang, Chuduan Yu, Ying |
author_facet | Yang, Ting Zhang, Fengxia Zhai, Liwei He, Weiyong Tan, Zhen Sun, Yangyang Wang, Yuan Liu, Lei Ning, Chao Zhou, Weiliang Ao, Hong Wang, Chuduan Yu, Ying |
author_sort | Yang, Ting |
collection | PubMed |
description | Porcine reproductive and respiratory syndrome virus (PRRSV) is a virus susceptible to antibody dependent enhancement, causing reproductive failures in sows and preweaning mortality of piglets. Modified-live virus (MLV) vaccines are used to control PRRS in swine herds. However, immunized sows and piglets often generate variable antibody levels. This study aimed to detect significant genes and pathways involved in antibody responsiveness of pregnant sows and their offspring post-PRRSV vaccination. RNA sequencing was conducted on peripheral blood-mononuclear cells (PBMCs), which were isolated from pregnant sows and their piglets with high (HA), median (MA), and low (LA) PRRS antibody levels following vaccination. 401 differentially expressed genes (DEGs) were identified in three comparisons (HA versus MA, HA versus LA, and MA versus LA) of sow PBMCs. Two novel pathways (complement and coagulation cascade pathway; and epithelial cell signaling in H. pylori infection pathway) revealed by DEGs in HA versus LA and MA versus LA were involved in chemotactic and proinflammatory responses. TNF-α, CCL4, and NFKBIA genes displayed the same expression trends in subsequent generation post-PRRS-MLV vaccination. Findings of the study suggest that two pathways and TNF-α, CCL4, and NFKBIA could be considered as key pathways and potential candidate genes for PRRSV vaccine responsiveness, respectively. |
format | Online Article Text |
id | pubmed-5802836 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-58028362018-02-14 Transcriptome of Porcine PBMCs over Two Generations Reveals Key Genes and Pathways Associated with Variable Antibody Responses post PRRSV Vaccination Yang, Ting Zhang, Fengxia Zhai, Liwei He, Weiyong Tan, Zhen Sun, Yangyang Wang, Yuan Liu, Lei Ning, Chao Zhou, Weiliang Ao, Hong Wang, Chuduan Yu, Ying Sci Rep Article Porcine reproductive and respiratory syndrome virus (PRRSV) is a virus susceptible to antibody dependent enhancement, causing reproductive failures in sows and preweaning mortality of piglets. Modified-live virus (MLV) vaccines are used to control PRRS in swine herds. However, immunized sows and piglets often generate variable antibody levels. This study aimed to detect significant genes and pathways involved in antibody responsiveness of pregnant sows and their offspring post-PRRSV vaccination. RNA sequencing was conducted on peripheral blood-mononuclear cells (PBMCs), which were isolated from pregnant sows and their piglets with high (HA), median (MA), and low (LA) PRRS antibody levels following vaccination. 401 differentially expressed genes (DEGs) were identified in three comparisons (HA versus MA, HA versus LA, and MA versus LA) of sow PBMCs. Two novel pathways (complement and coagulation cascade pathway; and epithelial cell signaling in H. pylori infection pathway) revealed by DEGs in HA versus LA and MA versus LA were involved in chemotactic and proinflammatory responses. TNF-α, CCL4, and NFKBIA genes displayed the same expression trends in subsequent generation post-PRRS-MLV vaccination. Findings of the study suggest that two pathways and TNF-α, CCL4, and NFKBIA could be considered as key pathways and potential candidate genes for PRRSV vaccine responsiveness, respectively. Nature Publishing Group UK 2018-02-06 /pmc/articles/PMC5802836/ /pubmed/29410429 http://dx.doi.org/10.1038/s41598-018-20701-w Text en © The Author(s) 2018 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Yang, Ting Zhang, Fengxia Zhai, Liwei He, Weiyong Tan, Zhen Sun, Yangyang Wang, Yuan Liu, Lei Ning, Chao Zhou, Weiliang Ao, Hong Wang, Chuduan Yu, Ying Transcriptome of Porcine PBMCs over Two Generations Reveals Key Genes and Pathways Associated with Variable Antibody Responses post PRRSV Vaccination |
title | Transcriptome of Porcine PBMCs over Two Generations Reveals Key Genes and Pathways Associated with Variable Antibody Responses post PRRSV Vaccination |
title_full | Transcriptome of Porcine PBMCs over Two Generations Reveals Key Genes and Pathways Associated with Variable Antibody Responses post PRRSV Vaccination |
title_fullStr | Transcriptome of Porcine PBMCs over Two Generations Reveals Key Genes and Pathways Associated with Variable Antibody Responses post PRRSV Vaccination |
title_full_unstemmed | Transcriptome of Porcine PBMCs over Two Generations Reveals Key Genes and Pathways Associated with Variable Antibody Responses post PRRSV Vaccination |
title_short | Transcriptome of Porcine PBMCs over Two Generations Reveals Key Genes and Pathways Associated with Variable Antibody Responses post PRRSV Vaccination |
title_sort | transcriptome of porcine pbmcs over two generations reveals key genes and pathways associated with variable antibody responses post prrsv vaccination |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5802836/ https://www.ncbi.nlm.nih.gov/pubmed/29410429 http://dx.doi.org/10.1038/s41598-018-20701-w |
work_keys_str_mv | AT yangting transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT zhangfengxia transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT zhailiwei transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT heweiyong transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT tanzhen transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT sunyangyang transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT wangyuan transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT liulei transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT ningchao transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT zhouweiliang transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT aohong transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT wangchuduan transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination AT yuying transcriptomeofporcinepbmcsovertwogenerationsrevealskeygenesandpathwaysassociatedwithvariableantibodyresponsespostprrsvvaccination |