Cargando…

Navigating the sustainability landscape: a systematic review of sustainability approaches in healthcare

BACKGROUND: Improvement initiatives offer a valuable mechanism for delivering and testing innovations in healthcare settings. Many of these initiatives deliver meaningful and necessary changes to patient care and outcomes. However, many improvement initiatives fail to sustain to a point where their...

Descripción completa

Detalles Bibliográficos
Autores principales: Lennox, L., Maher, L., Reed, J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5810192/
https://www.ncbi.nlm.nih.gov/pubmed/29426341
http://dx.doi.org/10.1186/s13012-017-0707-4
_version_ 1783299704738545664
author Lennox, L.
Maher, L.
Reed, J.
author_facet Lennox, L.
Maher, L.
Reed, J.
author_sort Lennox, L.
collection PubMed
description BACKGROUND: Improvement initiatives offer a valuable mechanism for delivering and testing innovations in healthcare settings. Many of these initiatives deliver meaningful and necessary changes to patient care and outcomes. However, many improvement initiatives fail to sustain to a point where their full benefits can be realised. This has led many researchers and healthcare practitioners to develop frameworks, models and tools to support and monitor sustainability. This work aimed to identify what approaches are available to assess and influence sustainability in healthcare and to describe the different perspectives, applications and constructs within these approaches to guide their future use. METHODS: A systematic review was carried out following PRISMA guidelines to identify publications that reported approaches to support or influence sustainability in healthcare. Eligibility criteria were defined through an iterative process in which two reviewers independently assessed 20% of articles to test the objectivity of the selection criteria. Data were extracted from the identified articles, and a template analysis was undertaken to identify and assess the sustainability constructs within each reported approach. RESULTS: The search strategy identified 1748 publications with 227 articles retrieved in full text for full documentary analysis. In total, 62 publications identifying a sustainability approach were included in this review (32 frameworks, 16 models, 8 tools, 4 strategies, 1 checklist and 1 process). Constructs across approaches were compared and 40 individual constructs for sustainability were found. Comparison across approaches demonstrated consistent constructs were seen regardless of proposed interventions, setting or level of application with 6 constructs included in 75% of the approaches. Although similarities were found, no approaches contained the same combination of the constructs nor did any single approach capture all identified constructs. From these results, a consolidated framework for sustainability constructs in healthcare was developed. CONCLUSIONS: Choosing a sustainability method can pose a challenge because of the diverse approaches reported in the literature. This review provides a valuable resource to researchers, healthcare professionals and improvement practitioners by providing a summary of available sustainability approaches and their characteristics. TRIAL REGISTRATION: This review was registered on the PROSPERO database: CRD42016040081 in June 2016. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13012-017-0707-4) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5810192
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-58101922018-02-16 Navigating the sustainability landscape: a systematic review of sustainability approaches in healthcare Lennox, L. Maher, L. Reed, J. Implement Sci Systematic Review BACKGROUND: Improvement initiatives offer a valuable mechanism for delivering and testing innovations in healthcare settings. Many of these initiatives deliver meaningful and necessary changes to patient care and outcomes. However, many improvement initiatives fail to sustain to a point where their full benefits can be realised. This has led many researchers and healthcare practitioners to develop frameworks, models and tools to support and monitor sustainability. This work aimed to identify what approaches are available to assess and influence sustainability in healthcare and to describe the different perspectives, applications and constructs within these approaches to guide their future use. METHODS: A systematic review was carried out following PRISMA guidelines to identify publications that reported approaches to support or influence sustainability in healthcare. Eligibility criteria were defined through an iterative process in which two reviewers independently assessed 20% of articles to test the objectivity of the selection criteria. Data were extracted from the identified articles, and a template analysis was undertaken to identify and assess the sustainability constructs within each reported approach. RESULTS: The search strategy identified 1748 publications with 227 articles retrieved in full text for full documentary analysis. In total, 62 publications identifying a sustainability approach were included in this review (32 frameworks, 16 models, 8 tools, 4 strategies, 1 checklist and 1 process). Constructs across approaches were compared and 40 individual constructs for sustainability were found. Comparison across approaches demonstrated consistent constructs were seen regardless of proposed interventions, setting or level of application with 6 constructs included in 75% of the approaches. Although similarities were found, no approaches contained the same combination of the constructs nor did any single approach capture all identified constructs. From these results, a consolidated framework for sustainability constructs in healthcare was developed. CONCLUSIONS: Choosing a sustainability method can pose a challenge because of the diverse approaches reported in the literature. This review provides a valuable resource to researchers, healthcare professionals and improvement practitioners by providing a summary of available sustainability approaches and their characteristics. TRIAL REGISTRATION: This review was registered on the PROSPERO database: CRD42016040081 in June 2016. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13012-017-0707-4) contains supplementary material, which is available to authorized users. BioMed Central 2018-02-09 /pmc/articles/PMC5810192/ /pubmed/29426341 http://dx.doi.org/10.1186/s13012-017-0707-4 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Systematic Review
Lennox, L.
Maher, L.
Reed, J.
Navigating the sustainability landscape: a systematic review of sustainability approaches in healthcare
title Navigating the sustainability landscape: a systematic review of sustainability approaches in healthcare
title_full Navigating the sustainability landscape: a systematic review of sustainability approaches in healthcare
title_fullStr Navigating the sustainability landscape: a systematic review of sustainability approaches in healthcare
title_full_unstemmed Navigating the sustainability landscape: a systematic review of sustainability approaches in healthcare
title_short Navigating the sustainability landscape: a systematic review of sustainability approaches in healthcare
title_sort navigating the sustainability landscape: a systematic review of sustainability approaches in healthcare
topic Systematic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5810192/
https://www.ncbi.nlm.nih.gov/pubmed/29426341
http://dx.doi.org/10.1186/s13012-017-0707-4
work_keys_str_mv AT lennoxl navigatingthesustainabilitylandscapeasystematicreviewofsustainabilityapproachesinhealthcare
AT maherl navigatingthesustainabilitylandscapeasystematicreviewofsustainabilityapproachesinhealthcare
AT reedj navigatingthesustainabilitylandscapeasystematicreviewofsustainabilityapproachesinhealthcare