Cargando…

Effects of physical exercise programs on cognitive function in Parkinson’s disease patients: A systematic review of randomized controlled trials of the last 10 years

BACKGROUND: Given the relative importance of cognitive impairment, there was considerable interest in identifying the cognitive profile of PD patients, in order to ensure specific and appropriate therapeutic interventions. PURPOSE: To determine the effects of physical exercise programs on cognitive...

Descripción completa

Detalles Bibliográficos
Autores principales: da Silva, Franciele Cascaes, Iop, Rodrigo da Rosa, de Oliveira, Laiana Cândido, Boll, Alice Mathea, de Alvarenga, José Gustavo Souza, Gutierres Filho, Paulo José Barbosa, de Melo, Lídia Mara Aguiar Bezerra, Xavier, André Junqueira, da Silva, Rudney
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5828448/
https://www.ncbi.nlm.nih.gov/pubmed/29486000
http://dx.doi.org/10.1371/journal.pone.0193113
_version_ 1783302648877809664
author da Silva, Franciele Cascaes
Iop, Rodrigo da Rosa
de Oliveira, Laiana Cândido
Boll, Alice Mathea
de Alvarenga, José Gustavo Souza
Gutierres Filho, Paulo José Barbosa
de Melo, Lídia Mara Aguiar Bezerra
Xavier, André Junqueira
da Silva, Rudney
author_facet da Silva, Franciele Cascaes
Iop, Rodrigo da Rosa
de Oliveira, Laiana Cândido
Boll, Alice Mathea
de Alvarenga, José Gustavo Souza
Gutierres Filho, Paulo José Barbosa
de Melo, Lídia Mara Aguiar Bezerra
Xavier, André Junqueira
da Silva, Rudney
author_sort da Silva, Franciele Cascaes
collection PubMed
description BACKGROUND: Given the relative importance of cognitive impairment, there was considerable interest in identifying the cognitive profile of PD patients, in order to ensure specific and appropriate therapeutic interventions. PURPOSE: To determine the effects of physical exercise programs on cognitive function in PD patients, compared with the control group. DATA SOURCES: Medline, Cochrane, Scopus, PEDro and Web of Science (last searched in September 2016). STUDY SELECTION: Randomized clinical trials examining the effects of physical exercise programs and cognitive function in PD patients. Nine studies fulfilled the selection criteria and were included in this review. DATA EXTRACTION: Characteristics of the publication, characteristics of the participants, test used for cognitive screening, cognitive domain assessed, tools used to assess cognitive function, characteristics of the experimental intervention, characteristics of the control group, mean results and standard deviation of function cognitive. The PEDro score was used to evaluate methodological quality. DATA SYNTHESIS: Most eligible studies showed good methodological quality based on the PEDro scale. Studies have shown that adapted tango for PD patients, cognitive training combined with motor training, and treadmill training promote the preservation or improvement of cognitive function in PD patients. LIMITATIONS: The diversity of cognitive tests used to assess cognitive function and the high heterogeneity identified between the physical exercise programs. CONCLUSIONS: Physical exercise programs promote positive and significant effects on global cognitive function, processing speed, sustained attention and mental flexibility in PD patients, at a mild to moderate stage for patients with a 6-year clinical diagnosis of PD. However, treadmill training performed 3 times a week for about 60 minutes and for a period of 24 weeks produced larger improvements in cognition.
format Online
Article
Text
id pubmed-5828448
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-58284482018-03-19 Effects of physical exercise programs on cognitive function in Parkinson’s disease patients: A systematic review of randomized controlled trials of the last 10 years da Silva, Franciele Cascaes Iop, Rodrigo da Rosa de Oliveira, Laiana Cândido Boll, Alice Mathea de Alvarenga, José Gustavo Souza Gutierres Filho, Paulo José Barbosa de Melo, Lídia Mara Aguiar Bezerra Xavier, André Junqueira da Silva, Rudney PLoS One Research Article BACKGROUND: Given the relative importance of cognitive impairment, there was considerable interest in identifying the cognitive profile of PD patients, in order to ensure specific and appropriate therapeutic interventions. PURPOSE: To determine the effects of physical exercise programs on cognitive function in PD patients, compared with the control group. DATA SOURCES: Medline, Cochrane, Scopus, PEDro and Web of Science (last searched in September 2016). STUDY SELECTION: Randomized clinical trials examining the effects of physical exercise programs and cognitive function in PD patients. Nine studies fulfilled the selection criteria and were included in this review. DATA EXTRACTION: Characteristics of the publication, characteristics of the participants, test used for cognitive screening, cognitive domain assessed, tools used to assess cognitive function, characteristics of the experimental intervention, characteristics of the control group, mean results and standard deviation of function cognitive. The PEDro score was used to evaluate methodological quality. DATA SYNTHESIS: Most eligible studies showed good methodological quality based on the PEDro scale. Studies have shown that adapted tango for PD patients, cognitive training combined with motor training, and treadmill training promote the preservation or improvement of cognitive function in PD patients. LIMITATIONS: The diversity of cognitive tests used to assess cognitive function and the high heterogeneity identified between the physical exercise programs. CONCLUSIONS: Physical exercise programs promote positive and significant effects on global cognitive function, processing speed, sustained attention and mental flexibility in PD patients, at a mild to moderate stage for patients with a 6-year clinical diagnosis of PD. However, treadmill training performed 3 times a week for about 60 minutes and for a period of 24 weeks produced larger improvements in cognition. Public Library of Science 2018-02-27 /pmc/articles/PMC5828448/ /pubmed/29486000 http://dx.doi.org/10.1371/journal.pone.0193113 Text en © 2018 da Silva et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
da Silva, Franciele Cascaes
Iop, Rodrigo da Rosa
de Oliveira, Laiana Cândido
Boll, Alice Mathea
de Alvarenga, José Gustavo Souza
Gutierres Filho, Paulo José Barbosa
de Melo, Lídia Mara Aguiar Bezerra
Xavier, André Junqueira
da Silva, Rudney
Effects of physical exercise programs on cognitive function in Parkinson’s disease patients: A systematic review of randomized controlled trials of the last 10 years
title Effects of physical exercise programs on cognitive function in Parkinson’s disease patients: A systematic review of randomized controlled trials of the last 10 years
title_full Effects of physical exercise programs on cognitive function in Parkinson’s disease patients: A systematic review of randomized controlled trials of the last 10 years
title_fullStr Effects of physical exercise programs on cognitive function in Parkinson’s disease patients: A systematic review of randomized controlled trials of the last 10 years
title_full_unstemmed Effects of physical exercise programs on cognitive function in Parkinson’s disease patients: A systematic review of randomized controlled trials of the last 10 years
title_short Effects of physical exercise programs on cognitive function in Parkinson’s disease patients: A systematic review of randomized controlled trials of the last 10 years
title_sort effects of physical exercise programs on cognitive function in parkinson’s disease patients: a systematic review of randomized controlled trials of the last 10 years
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5828448/
https://www.ncbi.nlm.nih.gov/pubmed/29486000
http://dx.doi.org/10.1371/journal.pone.0193113
work_keys_str_mv AT dasilvafrancielecascaes effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT ioprodrigodarosa effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT deoliveiralaianacandido effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT bollalicemathea effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT dealvarengajosegustavosouza effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT gutierresfilhopaulojosebarbosa effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT demelolidiamaraaguiarbezerra effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT xavierandrejunqueira effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years
AT dasilvarudney effectsofphysicalexerciseprogramsoncognitivefunctioninparkinsonsdiseasepatientsasystematicreviewofrandomizedcontrolledtrialsofthelast10years