Cargando…
Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences
Etoposide and other topoisomerase II-targeted drugs are important anticancer therapeutics. Unfortunately, the safe usage of these agents is limited by their indiscriminate induction of topoisomerase II-mediated DNA cleavage throughout the genome and by a lack of specificity toward cancer cells. Ther...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Oxford University Press
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5861436/ https://www.ncbi.nlm.nih.gov/pubmed/29447373 http://dx.doi.org/10.1093/nar/gky072 |
_version_ | 1783308094372052992 |
---|---|
author | Infante Lara, Lorena Fenner, Sabine Ratcliffe, Steven Isidro-Llobet, Albert Hann, Michael Bax, Ben Osheroff, Neil |
author_facet | Infante Lara, Lorena Fenner, Sabine Ratcliffe, Steven Isidro-Llobet, Albert Hann, Michael Bax, Ben Osheroff, Neil |
author_sort | Infante Lara, Lorena |
collection | PubMed |
description | Etoposide and other topoisomerase II-targeted drugs are important anticancer therapeutics. Unfortunately, the safe usage of these agents is limited by their indiscriminate induction of topoisomerase II-mediated DNA cleavage throughout the genome and by a lack of specificity toward cancer cells. Therefore, as a first step toward constraining the distribution of etoposide-induced DNA cleavage sites and developing sequence-specific topoisomerase II-targeted anticancer agents, we covalently coupled the core of etoposide to oligonucleotides centered on a topoisomerase II cleavage site in the PML gene. The initial sequence used for this ‘oligonucleotide-linked topoisomerase inhibitor’ (OTI) was identified as part of the translocation breakpoint of a patient with acute promyelocytic leukemia (APL). Subsequent OTI sequences were derived from the observed APL breakpoint between PML and RARA. Results indicate that OTIs can be used to direct the sites of etoposide-induced DNA cleavage mediated by topoisomerase IIα and topoisomerase IIβ. OTIs increased levels of enzyme-mediated cleavage by inhibiting DNA ligation, and cleavage complexes induced by OTIs were as stable as those induced by free etoposide. Finally, OTIs directed against the PML-RARA breakpoint displayed cleavage specificity for oligonucleotides with the translocation sequence over those with sequences matching either parental gene. These studies demonstrate the feasibility of using oligonucleotides to direct topoisomerase II-mediated DNA cleavage to specific sites in the genome. |
format | Online Article Text |
id | pubmed-5861436 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Oxford University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-58614362018-03-28 Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences Infante Lara, Lorena Fenner, Sabine Ratcliffe, Steven Isidro-Llobet, Albert Hann, Michael Bax, Ben Osheroff, Neil Nucleic Acids Res Chemical Biology and Nucleic Acid Chemistry Etoposide and other topoisomerase II-targeted drugs are important anticancer therapeutics. Unfortunately, the safe usage of these agents is limited by their indiscriminate induction of topoisomerase II-mediated DNA cleavage throughout the genome and by a lack of specificity toward cancer cells. Therefore, as a first step toward constraining the distribution of etoposide-induced DNA cleavage sites and developing sequence-specific topoisomerase II-targeted anticancer agents, we covalently coupled the core of etoposide to oligonucleotides centered on a topoisomerase II cleavage site in the PML gene. The initial sequence used for this ‘oligonucleotide-linked topoisomerase inhibitor’ (OTI) was identified as part of the translocation breakpoint of a patient with acute promyelocytic leukemia (APL). Subsequent OTI sequences were derived from the observed APL breakpoint between PML and RARA. Results indicate that OTIs can be used to direct the sites of etoposide-induced DNA cleavage mediated by topoisomerase IIα and topoisomerase IIβ. OTIs increased levels of enzyme-mediated cleavage by inhibiting DNA ligation, and cleavage complexes induced by OTIs were as stable as those induced by free etoposide. Finally, OTIs directed against the PML-RARA breakpoint displayed cleavage specificity for oligonucleotides with the translocation sequence over those with sequences matching either parental gene. These studies demonstrate the feasibility of using oligonucleotides to direct topoisomerase II-mediated DNA cleavage to specific sites in the genome. Oxford University Press 2018-03-16 2018-02-13 /pmc/articles/PMC5861436/ /pubmed/29447373 http://dx.doi.org/10.1093/nar/gky072 Text en © The Author(s) 2018. Published by Oxford University Press on behalf of Nucleic Acids Research. http://creativecommons.org/licenses/by-nc/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by-nc/4.0/), which permits non-commercial re-use, distribution, and reproduction in any medium, provided the original work is properly cited. For commercial re-use, please contact journals.permissions@oup.com |
spellingShingle | Chemical Biology and Nucleic Acid Chemistry Infante Lara, Lorena Fenner, Sabine Ratcliffe, Steven Isidro-Llobet, Albert Hann, Michael Bax, Ben Osheroff, Neil Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences |
title | Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences |
title_full | Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences |
title_fullStr | Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences |
title_full_unstemmed | Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences |
title_short | Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences |
title_sort | coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase ii-mediated cleavage at specific dna sequences |
topic | Chemical Biology and Nucleic Acid Chemistry |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5861436/ https://www.ncbi.nlm.nih.gov/pubmed/29447373 http://dx.doi.org/10.1093/nar/gky072 |
work_keys_str_mv | AT infantelaralorena couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences AT fennersabine couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences AT ratcliffesteven couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences AT isidrollobetalbert couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences AT hannmichael couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences AT baxben couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences AT osheroffneil couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences |