Cargando…

Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences

Etoposide and other topoisomerase II-targeted drugs are important anticancer therapeutics. Unfortunately, the safe usage of these agents is limited by their indiscriminate induction of topoisomerase II-mediated DNA cleavage throughout the genome and by a lack of specificity toward cancer cells. Ther...

Descripción completa

Detalles Bibliográficos
Autores principales: Infante Lara, Lorena, Fenner, Sabine, Ratcliffe, Steven, Isidro-Llobet, Albert, Hann, Michael, Bax, Ben, Osheroff, Neil
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Oxford University Press 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5861436/
https://www.ncbi.nlm.nih.gov/pubmed/29447373
http://dx.doi.org/10.1093/nar/gky072
_version_ 1783308094372052992
author Infante Lara, Lorena
Fenner, Sabine
Ratcliffe, Steven
Isidro-Llobet, Albert
Hann, Michael
Bax, Ben
Osheroff, Neil
author_facet Infante Lara, Lorena
Fenner, Sabine
Ratcliffe, Steven
Isidro-Llobet, Albert
Hann, Michael
Bax, Ben
Osheroff, Neil
author_sort Infante Lara, Lorena
collection PubMed
description Etoposide and other topoisomerase II-targeted drugs are important anticancer therapeutics. Unfortunately, the safe usage of these agents is limited by their indiscriminate induction of topoisomerase II-mediated DNA cleavage throughout the genome and by a lack of specificity toward cancer cells. Therefore, as a first step toward constraining the distribution of etoposide-induced DNA cleavage sites and developing sequence-specific topoisomerase II-targeted anticancer agents, we covalently coupled the core of etoposide to oligonucleotides centered on a topoisomerase II cleavage site in the PML gene. The initial sequence used for this ‘oligonucleotide-linked topoisomerase inhibitor’ (OTI) was identified as part of the translocation breakpoint of a patient with acute promyelocytic leukemia (APL). Subsequent OTI sequences were derived from the observed APL breakpoint between PML and RARA. Results indicate that OTIs can be used to direct the sites of etoposide-induced DNA cleavage mediated by topoisomerase IIα and topoisomerase IIβ. OTIs increased levels of enzyme-mediated cleavage by inhibiting DNA ligation, and cleavage complexes induced by OTIs were as stable as those induced by free etoposide. Finally, OTIs directed against the PML-RARA breakpoint displayed cleavage specificity for oligonucleotides with the translocation sequence over those with sequences matching either parental gene. These studies demonstrate the feasibility of using oligonucleotides to direct topoisomerase II-mediated DNA cleavage to specific sites in the genome.
format Online
Article
Text
id pubmed-5861436
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Oxford University Press
record_format MEDLINE/PubMed
spelling pubmed-58614362018-03-28 Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences Infante Lara, Lorena Fenner, Sabine Ratcliffe, Steven Isidro-Llobet, Albert Hann, Michael Bax, Ben Osheroff, Neil Nucleic Acids Res Chemical Biology and Nucleic Acid Chemistry Etoposide and other topoisomerase II-targeted drugs are important anticancer therapeutics. Unfortunately, the safe usage of these agents is limited by their indiscriminate induction of topoisomerase II-mediated DNA cleavage throughout the genome and by a lack of specificity toward cancer cells. Therefore, as a first step toward constraining the distribution of etoposide-induced DNA cleavage sites and developing sequence-specific topoisomerase II-targeted anticancer agents, we covalently coupled the core of etoposide to oligonucleotides centered on a topoisomerase II cleavage site in the PML gene. The initial sequence used for this ‘oligonucleotide-linked topoisomerase inhibitor’ (OTI) was identified as part of the translocation breakpoint of a patient with acute promyelocytic leukemia (APL). Subsequent OTI sequences were derived from the observed APL breakpoint between PML and RARA. Results indicate that OTIs can be used to direct the sites of etoposide-induced DNA cleavage mediated by topoisomerase IIα and topoisomerase IIβ. OTIs increased levels of enzyme-mediated cleavage by inhibiting DNA ligation, and cleavage complexes induced by OTIs were as stable as those induced by free etoposide. Finally, OTIs directed against the PML-RARA breakpoint displayed cleavage specificity for oligonucleotides with the translocation sequence over those with sequences matching either parental gene. These studies demonstrate the feasibility of using oligonucleotides to direct topoisomerase II-mediated DNA cleavage to specific sites in the genome. Oxford University Press 2018-03-16 2018-02-13 /pmc/articles/PMC5861436/ /pubmed/29447373 http://dx.doi.org/10.1093/nar/gky072 Text en © The Author(s) 2018. Published by Oxford University Press on behalf of Nucleic Acids Research. http://creativecommons.org/licenses/by-nc/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by-nc/4.0/), which permits non-commercial re-use, distribution, and reproduction in any medium, provided the original work is properly cited. For commercial re-use, please contact journals.permissions@oup.com
spellingShingle Chemical Biology and Nucleic Acid Chemistry
Infante Lara, Lorena
Fenner, Sabine
Ratcliffe, Steven
Isidro-Llobet, Albert
Hann, Michael
Bax, Ben
Osheroff, Neil
Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences
title Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences
title_full Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences
title_fullStr Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences
title_full_unstemmed Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences
title_short Coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase II-mediated cleavage at specific DNA sequences
title_sort coupling the core of the anticancer drug etoposide to an oligonucleotide induces topoisomerase ii-mediated cleavage at specific dna sequences
topic Chemical Biology and Nucleic Acid Chemistry
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5861436/
https://www.ncbi.nlm.nih.gov/pubmed/29447373
http://dx.doi.org/10.1093/nar/gky072
work_keys_str_mv AT infantelaralorena couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences
AT fennersabine couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences
AT ratcliffesteven couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences
AT isidrollobetalbert couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences
AT hannmichael couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences
AT baxben couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences
AT osheroffneil couplingthecoreoftheanticancerdrugetoposidetoanoligonucleotideinducestopoisomeraseiimediatedcleavageatspecificdnasequences