Cargando…
A high-resolution genetic linkage map and QTL fine mapping for growth-related traits and sex in the Yangtze River common carp (Cyprinus carpio haematopterus)
BACKGROUND: A high-density genetic linkage map is essential for QTL fine mapping, comparative genome analysis, identification of candidate genes and marker-assisted selection for economic traits in aquaculture species. The Yangtze River common carp (Cyprinus carpio haematopterus) is one of the most...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5879560/ https://www.ncbi.nlm.nih.gov/pubmed/29609551 http://dx.doi.org/10.1186/s12864-018-4613-1 |
_version_ | 1783311020331106304 |
---|---|
author | Feng, Xiu Yu, Xiaomu Fu, Beide Wang, Xinhua Liu, Haiyang Pang, Meixia Tong, Jingou |
author_facet | Feng, Xiu Yu, Xiaomu Fu, Beide Wang, Xinhua Liu, Haiyang Pang, Meixia Tong, Jingou |
author_sort | Feng, Xiu |
collection | PubMed |
description | BACKGROUND: A high-density genetic linkage map is essential for QTL fine mapping, comparative genome analysis, identification of candidate genes and marker-assisted selection for economic traits in aquaculture species. The Yangtze River common carp (Cyprinus carpio haematopterus) is one of the most important aquacultured strains in China. However, quite limited genetics and genomics resources have been developed for genetic improvement of economic traits in such strain. RESULTS: A high-resolution genetic linkage map was constructed by using 7820 2b-RAD (2b-restriction site-associated DNA) and 295 microsatellite markers in a F2 family of the Yangtze River common carp (C. c. haematopterus). The length of the map was 4586.56 cM with an average marker interval of 0.57 cM. Comparative genome mapping revealed that a high proportion (70%) of markers with disagreed chromosome location was observed between C. c. haematopterus and another common carp strain (subspecies) C. c. carpio. A clear 2:1 relationship was observed between C. c. haematopterus linkage groups (LGs) and zebrafish (Danio rerio) chromosomes. Based on the genetic map, 21 QTLs for growth-related traits were detected on 12 LGs, and contributed values of phenotypic variance explained (PVE) ranging from 16.3 to 38.6%, with LOD scores ranging from 4.02 to 11.13. A genome-wide significant QTL (LOD = 10.83) and three chromosome-wide significant QTLs (mean LOD = 4.84) for sex were mapped on LG50 and LG24, respectively. A 1.4 cM confidence interval of QTL for all growth-related traits showed conserved synteny with a 2.06 M segment on chromosome 14 of D. rerio. Five potential candidate genes were identified by blast search in this genomic region, including a well-studied multi-functional growth related gene, Apelin. CONCLUSIONS: We mapped a set of suggestive and significant QTLs for growth-related traits and sex based on a high-density genetic linkage map using SNP and microsatellite markers for Yangtze River common carp. Several candidate growth genes were also identified from the QTL regions by comparative mapping. This genetic map would provide a basis for genome assembly and comparative genomics studies, and those QTL-derived candidate genes and genetic markers are useful genomic resources for marker-assisted selection (MAS) of growth-related traits in the Yangtze River common carp. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12864-018-4613-1) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5879560 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-58795602018-04-04 A high-resolution genetic linkage map and QTL fine mapping for growth-related traits and sex in the Yangtze River common carp (Cyprinus carpio haematopterus) Feng, Xiu Yu, Xiaomu Fu, Beide Wang, Xinhua Liu, Haiyang Pang, Meixia Tong, Jingou BMC Genomics Research Article BACKGROUND: A high-density genetic linkage map is essential for QTL fine mapping, comparative genome analysis, identification of candidate genes and marker-assisted selection for economic traits in aquaculture species. The Yangtze River common carp (Cyprinus carpio haematopterus) is one of the most important aquacultured strains in China. However, quite limited genetics and genomics resources have been developed for genetic improvement of economic traits in such strain. RESULTS: A high-resolution genetic linkage map was constructed by using 7820 2b-RAD (2b-restriction site-associated DNA) and 295 microsatellite markers in a F2 family of the Yangtze River common carp (C. c. haematopterus). The length of the map was 4586.56 cM with an average marker interval of 0.57 cM. Comparative genome mapping revealed that a high proportion (70%) of markers with disagreed chromosome location was observed between C. c. haematopterus and another common carp strain (subspecies) C. c. carpio. A clear 2:1 relationship was observed between C. c. haematopterus linkage groups (LGs) and zebrafish (Danio rerio) chromosomes. Based on the genetic map, 21 QTLs for growth-related traits were detected on 12 LGs, and contributed values of phenotypic variance explained (PVE) ranging from 16.3 to 38.6%, with LOD scores ranging from 4.02 to 11.13. A genome-wide significant QTL (LOD = 10.83) and three chromosome-wide significant QTLs (mean LOD = 4.84) for sex were mapped on LG50 and LG24, respectively. A 1.4 cM confidence interval of QTL for all growth-related traits showed conserved synteny with a 2.06 M segment on chromosome 14 of D. rerio. Five potential candidate genes were identified by blast search in this genomic region, including a well-studied multi-functional growth related gene, Apelin. CONCLUSIONS: We mapped a set of suggestive and significant QTLs for growth-related traits and sex based on a high-density genetic linkage map using SNP and microsatellite markers for Yangtze River common carp. Several candidate growth genes were also identified from the QTL regions by comparative mapping. This genetic map would provide a basis for genome assembly and comparative genomics studies, and those QTL-derived candidate genes and genetic markers are useful genomic resources for marker-assisted selection (MAS) of growth-related traits in the Yangtze River common carp. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12864-018-4613-1) contains supplementary material, which is available to authorized users. BioMed Central 2018-04-02 /pmc/articles/PMC5879560/ /pubmed/29609551 http://dx.doi.org/10.1186/s12864-018-4613-1 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Feng, Xiu Yu, Xiaomu Fu, Beide Wang, Xinhua Liu, Haiyang Pang, Meixia Tong, Jingou A high-resolution genetic linkage map and QTL fine mapping for growth-related traits and sex in the Yangtze River common carp (Cyprinus carpio haematopterus) |
title | A high-resolution genetic linkage map and QTL fine mapping for growth-related traits and sex in the Yangtze River common carp (Cyprinus carpio haematopterus) |
title_full | A high-resolution genetic linkage map and QTL fine mapping for growth-related traits and sex in the Yangtze River common carp (Cyprinus carpio haematopterus) |
title_fullStr | A high-resolution genetic linkage map and QTL fine mapping for growth-related traits and sex in the Yangtze River common carp (Cyprinus carpio haematopterus) |
title_full_unstemmed | A high-resolution genetic linkage map and QTL fine mapping for growth-related traits and sex in the Yangtze River common carp (Cyprinus carpio haematopterus) |
title_short | A high-resolution genetic linkage map and QTL fine mapping for growth-related traits and sex in the Yangtze River common carp (Cyprinus carpio haematopterus) |
title_sort | high-resolution genetic linkage map and qtl fine mapping for growth-related traits and sex in the yangtze river common carp (cyprinus carpio haematopterus) |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5879560/ https://www.ncbi.nlm.nih.gov/pubmed/29609551 http://dx.doi.org/10.1186/s12864-018-4613-1 |
work_keys_str_mv | AT fengxiu ahighresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT yuxiaomu ahighresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT fubeide ahighresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT wangxinhua ahighresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT liuhaiyang ahighresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT pangmeixia ahighresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT tongjingou ahighresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT fengxiu highresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT yuxiaomu highresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT fubeide highresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT wangxinhua highresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT liuhaiyang highresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT pangmeixia highresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus AT tongjingou highresolutiongeneticlinkagemapandqtlfinemappingforgrowthrelatedtraitsandsexintheyangtzerivercommoncarpcyprinuscarpiohaematopterus |