Cargando…
Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome
BACKGROUND: Elevated serum levels of apolipoprotein (apo) C1 may be an early protein marker of metabolic abnormality in women with polycystic ovary syndrome (PCOS). It is not clear, however, whether there are any relationships between the apoC1 rs4420638A/G and -317deletion (H1)/insertion (H2) polym...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5894162/ https://www.ncbi.nlm.nih.gov/pubmed/29636060 http://dx.doi.org/10.1186/s12944-018-0725-5 |
_version_ | 1783313443846094848 |
---|---|
author | Zhang, Renjiao Liu, Qingqing Liu, Hongwei Bai, Huai Zhang, Yujin Guan, Linbo Fan, Ping |
author_facet | Zhang, Renjiao Liu, Qingqing Liu, Hongwei Bai, Huai Zhang, Yujin Guan, Linbo Fan, Ping |
author_sort | Zhang, Renjiao |
collection | PubMed |
description | BACKGROUND: Elevated serum levels of apolipoprotein (apo) C1 may be an early protein marker of metabolic abnormality in women with polycystic ovary syndrome (PCOS). It is not clear, however, whether there are any relationships between the apoC1 rs4420638A/G and -317deletion (H1)/insertion (H2) polymorphisms and PCOS. We investigated the relationship between these two variants and the risk of PCOS, evaluated the genotypic effects on clinical, hormonal and metabolic indexes and plasma platelet-activating factor acetylhydrolase (PAF-AH) activity, and defined the association of apoC1 gene variants with apoE ε2/ε3/ε4 polymorphisms. METHODS: This is a cross-sectional study of 877 women with PCOS and 761 controls. The apoC1 rs4420638A/G genotype was determined by a Taqman real-time PCR allelic discrimination assay. The apoC1–317H1/H2 and apoE ε2/ε3/ε4 genotypes were measured using PCR and restriction fragment length polymorphism analysis. The clinical, hormonal and metabolic parameters and PAF-AH activity were measured. RESULTS: The frequencies of apoC1 rs4420638A/G and -317H1/H2 genotypes and alleles were similar between PCOS and control groups (P > 0.05). However, the rs4420638 G allele was related to increased serum luteinizing hormone, cholesterol and apoB levels, and the ratio of apoB to apoA1 (P < 0.05), and the -317H1H1 genotype was associated with a higher acne grade score and a higher ratio of apoB-PAF-AH to H-PAF-AH activity (P < 0.05) in patients with PCOS. We also demonstrated that the apoC1 rs4420638A/G and -317H1/H2 gene variants existed in moderate to reasonably high linkage disequilibrium with apoE ε2/ε3/ε4 polymorphisms in Chinese women. CONCLUSION: The apoC1 rs4420638A/G and -317H1/H2 gene variants might be involved in endocrine abnormalities of reproductive axis, metabolic abnormalities and chronic inflammation in PCOS, although no association was observed between the apoC1 genetic variants and the risk of PCOS in Chinese women. |
format | Online Article Text |
id | pubmed-5894162 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-58941622018-04-12 Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome Zhang, Renjiao Liu, Qingqing Liu, Hongwei Bai, Huai Zhang, Yujin Guan, Linbo Fan, Ping Lipids Health Dis Research BACKGROUND: Elevated serum levels of apolipoprotein (apo) C1 may be an early protein marker of metabolic abnormality in women with polycystic ovary syndrome (PCOS). It is not clear, however, whether there are any relationships between the apoC1 rs4420638A/G and -317deletion (H1)/insertion (H2) polymorphisms and PCOS. We investigated the relationship between these two variants and the risk of PCOS, evaluated the genotypic effects on clinical, hormonal and metabolic indexes and plasma platelet-activating factor acetylhydrolase (PAF-AH) activity, and defined the association of apoC1 gene variants with apoE ε2/ε3/ε4 polymorphisms. METHODS: This is a cross-sectional study of 877 women with PCOS and 761 controls. The apoC1 rs4420638A/G genotype was determined by a Taqman real-time PCR allelic discrimination assay. The apoC1–317H1/H2 and apoE ε2/ε3/ε4 genotypes were measured using PCR and restriction fragment length polymorphism analysis. The clinical, hormonal and metabolic parameters and PAF-AH activity were measured. RESULTS: The frequencies of apoC1 rs4420638A/G and -317H1/H2 genotypes and alleles were similar between PCOS and control groups (P > 0.05). However, the rs4420638 G allele was related to increased serum luteinizing hormone, cholesterol and apoB levels, and the ratio of apoB to apoA1 (P < 0.05), and the -317H1H1 genotype was associated with a higher acne grade score and a higher ratio of apoB-PAF-AH to H-PAF-AH activity (P < 0.05) in patients with PCOS. We also demonstrated that the apoC1 rs4420638A/G and -317H1/H2 gene variants existed in moderate to reasonably high linkage disequilibrium with apoE ε2/ε3/ε4 polymorphisms in Chinese women. CONCLUSION: The apoC1 rs4420638A/G and -317H1/H2 gene variants might be involved in endocrine abnormalities of reproductive axis, metabolic abnormalities and chronic inflammation in PCOS, although no association was observed between the apoC1 genetic variants and the risk of PCOS in Chinese women. BioMed Central 2018-04-10 /pmc/articles/PMC5894162/ /pubmed/29636060 http://dx.doi.org/10.1186/s12944-018-0725-5 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Zhang, Renjiao Liu, Qingqing Liu, Hongwei Bai, Huai Zhang, Yujin Guan, Linbo Fan, Ping Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome |
title | Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome |
title_full | Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome |
title_fullStr | Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome |
title_full_unstemmed | Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome |
title_short | Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome |
title_sort | effects of apoc1 genotypes on the hormonal levels, metabolic profile and paf-ah activity in chinese women with polycystic ovary syndrome |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5894162/ https://www.ncbi.nlm.nih.gov/pubmed/29636060 http://dx.doi.org/10.1186/s12944-018-0725-5 |
work_keys_str_mv | AT zhangrenjiao effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome AT liuqingqing effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome AT liuhongwei effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome AT baihuai effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome AT zhangyujin effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome AT guanlinbo effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome AT fanping effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome |