Cargando…

Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome

BACKGROUND: Elevated serum levels of apolipoprotein (apo) C1 may be an early protein marker of metabolic abnormality in women with polycystic ovary syndrome (PCOS). It is not clear, however, whether there are any relationships between the apoC1 rs4420638A/G and -317deletion (H1)/insertion (H2) polym...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhang, Renjiao, Liu, Qingqing, Liu, Hongwei, Bai, Huai, Zhang, Yujin, Guan, Linbo, Fan, Ping
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5894162/
https://www.ncbi.nlm.nih.gov/pubmed/29636060
http://dx.doi.org/10.1186/s12944-018-0725-5
_version_ 1783313443846094848
author Zhang, Renjiao
Liu, Qingqing
Liu, Hongwei
Bai, Huai
Zhang, Yujin
Guan, Linbo
Fan, Ping
author_facet Zhang, Renjiao
Liu, Qingqing
Liu, Hongwei
Bai, Huai
Zhang, Yujin
Guan, Linbo
Fan, Ping
author_sort Zhang, Renjiao
collection PubMed
description BACKGROUND: Elevated serum levels of apolipoprotein (apo) C1 may be an early protein marker of metabolic abnormality in women with polycystic ovary syndrome (PCOS). It is not clear, however, whether there are any relationships between the apoC1 rs4420638A/G and -317deletion (H1)/insertion (H2) polymorphisms and PCOS. We investigated the relationship between these two variants and the risk of PCOS, evaluated the genotypic effects on clinical, hormonal and metabolic indexes and plasma platelet-activating factor acetylhydrolase (PAF-AH) activity, and defined the association of apoC1 gene variants with apoE ε2/ε3/ε4 polymorphisms. METHODS: This is a cross-sectional study of 877 women with PCOS and 761 controls. The apoC1 rs4420638A/G genotype was determined by a Taqman real-time PCR allelic discrimination assay. The apoC1–317H1/H2 and apoE ε2/ε3/ε4 genotypes were measured using PCR and restriction fragment length polymorphism analysis. The clinical, hormonal and metabolic parameters and PAF-AH activity were measured. RESULTS: The frequencies of apoC1 rs4420638A/G and -317H1/H2 genotypes and alleles were similar between PCOS and control groups (P > 0.05). However, the rs4420638 G allele was related to increased serum luteinizing hormone, cholesterol and apoB levels, and the ratio of apoB to apoA1 (P < 0.05), and the -317H1H1 genotype was associated with a higher acne grade score and a higher ratio of apoB-PAF-AH to H-PAF-AH activity (P < 0.05) in patients with PCOS. We also demonstrated that the apoC1 rs4420638A/G and -317H1/H2 gene variants existed in moderate to reasonably high linkage disequilibrium with apoE ε2/ε3/ε4 polymorphisms in Chinese women. CONCLUSION: The apoC1 rs4420638A/G and -317H1/H2 gene variants might be involved in endocrine abnormalities of reproductive axis, metabolic abnormalities and chronic inflammation in PCOS, although no association was observed between the apoC1 genetic variants and the risk of PCOS in Chinese women.
format Online
Article
Text
id pubmed-5894162
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-58941622018-04-12 Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome Zhang, Renjiao Liu, Qingqing Liu, Hongwei Bai, Huai Zhang, Yujin Guan, Linbo Fan, Ping Lipids Health Dis Research BACKGROUND: Elevated serum levels of apolipoprotein (apo) C1 may be an early protein marker of metabolic abnormality in women with polycystic ovary syndrome (PCOS). It is not clear, however, whether there are any relationships between the apoC1 rs4420638A/G and -317deletion (H1)/insertion (H2) polymorphisms and PCOS. We investigated the relationship between these two variants and the risk of PCOS, evaluated the genotypic effects on clinical, hormonal and metabolic indexes and plasma platelet-activating factor acetylhydrolase (PAF-AH) activity, and defined the association of apoC1 gene variants with apoE ε2/ε3/ε4 polymorphisms. METHODS: This is a cross-sectional study of 877 women with PCOS and 761 controls. The apoC1 rs4420638A/G genotype was determined by a Taqman real-time PCR allelic discrimination assay. The apoC1–317H1/H2 and apoE ε2/ε3/ε4 genotypes were measured using PCR and restriction fragment length polymorphism analysis. The clinical, hormonal and metabolic parameters and PAF-AH activity were measured. RESULTS: The frequencies of apoC1 rs4420638A/G and -317H1/H2 genotypes and alleles were similar between PCOS and control groups (P > 0.05). However, the rs4420638 G allele was related to increased serum luteinizing hormone, cholesterol and apoB levels, and the ratio of apoB to apoA1 (P < 0.05), and the -317H1H1 genotype was associated with a higher acne grade score and a higher ratio of apoB-PAF-AH to H-PAF-AH activity (P < 0.05) in patients with PCOS. We also demonstrated that the apoC1 rs4420638A/G and -317H1/H2 gene variants existed in moderate to reasonably high linkage disequilibrium with apoE ε2/ε3/ε4 polymorphisms in Chinese women. CONCLUSION: The apoC1 rs4420638A/G and -317H1/H2 gene variants might be involved in endocrine abnormalities of reproductive axis, metabolic abnormalities and chronic inflammation in PCOS, although no association was observed between the apoC1 genetic variants and the risk of PCOS in Chinese women. BioMed Central 2018-04-10 /pmc/articles/PMC5894162/ /pubmed/29636060 http://dx.doi.org/10.1186/s12944-018-0725-5 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Zhang, Renjiao
Liu, Qingqing
Liu, Hongwei
Bai, Huai
Zhang, Yujin
Guan, Linbo
Fan, Ping
Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome
title Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome
title_full Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome
title_fullStr Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome
title_full_unstemmed Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome
title_short Effects of apoC1 genotypes on the hormonal levels, metabolic profile and PAF-AH activity in Chinese women with polycystic ovary syndrome
title_sort effects of apoc1 genotypes on the hormonal levels, metabolic profile and paf-ah activity in chinese women with polycystic ovary syndrome
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5894162/
https://www.ncbi.nlm.nih.gov/pubmed/29636060
http://dx.doi.org/10.1186/s12944-018-0725-5
work_keys_str_mv AT zhangrenjiao effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome
AT liuqingqing effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome
AT liuhongwei effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome
AT baihuai effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome
AT zhangyujin effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome
AT guanlinbo effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome
AT fanping effectsofapoc1genotypesonthehormonallevelsmetabolicprofileandpafahactivityinchinesewomenwithpolycysticovarysyndrome