Cargando…

Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study

BACKGROUND: Increasing routine HIV testing among key populations is a public health imperative, so improving access to acceptable testing options for those in need is a priority. Despite increasing targeted distribution and uptake of HIV self-sampling kits (SSKs) among men who have sex with men in t...

Descripción completa

Detalles Bibliográficos
Autores principales: Dodds, C., Mugweni, E., Phillips, G., Park, C., Young, I., Fakoya, F., Wayal, S., McDaid, L., Sachikonye, M., Chwaula, J., Flowers, P., Burns, F.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5899406/
https://www.ncbi.nlm.nih.gov/pubmed/29653536
http://dx.doi.org/10.1186/s12889-018-5256-5
_version_ 1783314271063506944
author Dodds, C.
Mugweni, E.
Phillips, G.
Park, C.
Young, I.
Fakoya, F.
Wayal, S.
McDaid, L.
Sachikonye, M.
Chwaula, J.
Flowers, P.
Burns, F.
author_facet Dodds, C.
Mugweni, E.
Phillips, G.
Park, C.
Young, I.
Fakoya, F.
Wayal, S.
McDaid, L.
Sachikonye, M.
Chwaula, J.
Flowers, P.
Burns, F.
author_sort Dodds, C.
collection PubMed
description BACKGROUND: Increasing routine HIV testing among key populations is a public health imperative, so improving access to acceptable testing options for those in need is a priority. Despite increasing targeted distribution and uptake of HIV self-sampling kits (SSKs) among men who have sex with men in the UK, little is known about why targeted SSK interventions for black African users are not as wide-spread or well-used. This paper addresses this key gap, offering insight into why some groups may be less likely than others to adopt certain types of SSK interventions in particular contexts. These data were collected during the development phase of a larger study to explore the feasibility and acceptability of targeted distribution of SSKs to black African people. METHODS: We undertook 6 focus groups with members of the public who self-identified as black African (n = 48), 6 groups with specialists providing HIV and social services to black African people (n = 53), and interviews with HIV specialist consultants and policy-makers (n = 9). Framework analysis was undertaken, using inductive and deductive analysis to develop and check themes. RESULTS: We found three valuable components of targeted SSK interventions for this population: the use of settings and technologies that increase choice and autonomy; targeted offers of HIV testing that preserve privacy and do not exacerbate HIV stigma; and ensuring that the specific kit being used (in this case, the TINY vial) is perceived as simple and reliable. CONCLUSIONS: This unique and rigorous research offers insights into participants’ views on SSK interventions, offering key considerations when targeting this population.. Given the plethora of HIV testing options, our work demonstrates that those commissioning and delivering SSK interventions will need to clarify (for users and providers) how each kit type and intervention design adds value. Most significantly, these findings demonstrate that without a strong locus of control over their own circumstances and personal information, black African people are less likely to feel that they can pursue an HIV test that is safe and secure. Thus, where profound social inequalities persist, so will inequalities in HIV testing uptake – by any means. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12889-018-5256-5) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5899406
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-58994062018-04-23 Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study Dodds, C. Mugweni, E. Phillips, G. Park, C. Young, I. Fakoya, F. Wayal, S. McDaid, L. Sachikonye, M. Chwaula, J. Flowers, P. Burns, F. BMC Public Health Research Article BACKGROUND: Increasing routine HIV testing among key populations is a public health imperative, so improving access to acceptable testing options for those in need is a priority. Despite increasing targeted distribution and uptake of HIV self-sampling kits (SSKs) among men who have sex with men in the UK, little is known about why targeted SSK interventions for black African users are not as wide-spread or well-used. This paper addresses this key gap, offering insight into why some groups may be less likely than others to adopt certain types of SSK interventions in particular contexts. These data were collected during the development phase of a larger study to explore the feasibility and acceptability of targeted distribution of SSKs to black African people. METHODS: We undertook 6 focus groups with members of the public who self-identified as black African (n = 48), 6 groups with specialists providing HIV and social services to black African people (n = 53), and interviews with HIV specialist consultants and policy-makers (n = 9). Framework analysis was undertaken, using inductive and deductive analysis to develop and check themes. RESULTS: We found three valuable components of targeted SSK interventions for this population: the use of settings and technologies that increase choice and autonomy; targeted offers of HIV testing that preserve privacy and do not exacerbate HIV stigma; and ensuring that the specific kit being used (in this case, the TINY vial) is perceived as simple and reliable. CONCLUSIONS: This unique and rigorous research offers insights into participants’ views on SSK interventions, offering key considerations when targeting this population.. Given the plethora of HIV testing options, our work demonstrates that those commissioning and delivering SSK interventions will need to clarify (for users and providers) how each kit type and intervention design adds value. Most significantly, these findings demonstrate that without a strong locus of control over their own circumstances and personal information, black African people are less likely to feel that they can pursue an HIV test that is safe and secure. Thus, where profound social inequalities persist, so will inequalities in HIV testing uptake – by any means. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12889-018-5256-5) contains supplementary material, which is available to authorized users. BioMed Central 2018-04-13 /pmc/articles/PMC5899406/ /pubmed/29653536 http://dx.doi.org/10.1186/s12889-018-5256-5 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Dodds, C.
Mugweni, E.
Phillips, G.
Park, C.
Young, I.
Fakoya, F.
Wayal, S.
McDaid, L.
Sachikonye, M.
Chwaula, J.
Flowers, P.
Burns, F.
Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study
title Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study
title_full Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study
title_fullStr Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study
title_full_unstemmed Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study
title_short Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study
title_sort acceptability of hiv self-sampling kits (tiny vial) among people of black african ethnicity in the uk: a qualitative study
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5899406/
https://www.ncbi.nlm.nih.gov/pubmed/29653536
http://dx.doi.org/10.1186/s12889-018-5256-5
work_keys_str_mv AT doddsc acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy
AT mugwenie acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy
AT phillipsg acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy
AT parkc acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy
AT youngi acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy
AT fakoyaf acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy
AT wayals acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy
AT mcdaidl acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy
AT sachikonyem acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy
AT chwaulaj acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy
AT flowersp acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy
AT burnsf acceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy