Cargando…
Improving social accountability processes in the health sector in sub-Saharan Africa: a systematic review
BACKGROUND: Social accountability is a participatory process in which citizens are engaged to hold politicians, policy makers and public officials accountable for the services that they provide. In the Fifteenth Ordinary Session of the Assembly of the African Union, African leaders recognized the ne...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5899409/ https://www.ncbi.nlm.nih.gov/pubmed/29653531 http://dx.doi.org/10.1186/s12889-018-5407-8 |
_version_ | 1783314271778635776 |
---|---|
author | Danhoundo, Georges Nasiri, Khalidha Wiktorowicz, Mary E. |
author_facet | Danhoundo, Georges Nasiri, Khalidha Wiktorowicz, Mary E. |
author_sort | Danhoundo, Georges |
collection | PubMed |
description | BACKGROUND: Social accountability is a participatory process in which citizens are engaged to hold politicians, policy makers and public officials accountable for the services that they provide. In the Fifteenth Ordinary Session of the Assembly of the African Union, African leaders recognized the need for strong, decentralized health programs with linkages to civil society and private sector entities, full community participation in program design and implementation, and adaptive approaches to local political, socio-cultural and administrative environments. Despite the increasing use of social accountability, there is limited evidence on how it has been used in the health sector. The objective of this systematic review was to identify the conditions that facilitate effective social accountability in sub-Saharan Africa. METHODS: Electronic databases (MEDLINE, PsycINFO, Sociological Abstracts, Social Sciences Abstracts) were searched for relevant articles published between 2000 and August 2017. Studies were eligible for inclusion if they were peer-reviewed English language publications describing a social accountability intervention in sub-Saharan Africa. Qualitative and quantitative study designs were eligible. RESULTS: Fourteen relevant studies were included in the review. The findings indicate that effective social accountability interventions involve leveraging partnerships and building coalitions; being context-appropriate; integrating data and information collection and analysis; clearly defined roles, standards, and responsibilities of leaders; and meaningful citizen engagement. Health system barriers, corruption, fear of reprisal, and limited funding appear to be major challenges to effective social accountability interventions. CONCLUSION: Although global accountability standards play an important guiding role, the successful implementation of global health initiatives depend on national contexts. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12889-018-5407-8) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5899409 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-58994092018-04-23 Improving social accountability processes in the health sector in sub-Saharan Africa: a systematic review Danhoundo, Georges Nasiri, Khalidha Wiktorowicz, Mary E. BMC Public Health Research Article BACKGROUND: Social accountability is a participatory process in which citizens are engaged to hold politicians, policy makers and public officials accountable for the services that they provide. In the Fifteenth Ordinary Session of the Assembly of the African Union, African leaders recognized the need for strong, decentralized health programs with linkages to civil society and private sector entities, full community participation in program design and implementation, and adaptive approaches to local political, socio-cultural and administrative environments. Despite the increasing use of social accountability, there is limited evidence on how it has been used in the health sector. The objective of this systematic review was to identify the conditions that facilitate effective social accountability in sub-Saharan Africa. METHODS: Electronic databases (MEDLINE, PsycINFO, Sociological Abstracts, Social Sciences Abstracts) were searched for relevant articles published between 2000 and August 2017. Studies were eligible for inclusion if they were peer-reviewed English language publications describing a social accountability intervention in sub-Saharan Africa. Qualitative and quantitative study designs were eligible. RESULTS: Fourteen relevant studies were included in the review. The findings indicate that effective social accountability interventions involve leveraging partnerships and building coalitions; being context-appropriate; integrating data and information collection and analysis; clearly defined roles, standards, and responsibilities of leaders; and meaningful citizen engagement. Health system barriers, corruption, fear of reprisal, and limited funding appear to be major challenges to effective social accountability interventions. CONCLUSION: Although global accountability standards play an important guiding role, the successful implementation of global health initiatives depend on national contexts. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12889-018-5407-8) contains supplementary material, which is available to authorized users. BioMed Central 2018-04-13 /pmc/articles/PMC5899409/ /pubmed/29653531 http://dx.doi.org/10.1186/s12889-018-5407-8 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Danhoundo, Georges Nasiri, Khalidha Wiktorowicz, Mary E. Improving social accountability processes in the health sector in sub-Saharan Africa: a systematic review |
title | Improving social accountability processes in the health sector in sub-Saharan Africa: a systematic review |
title_full | Improving social accountability processes in the health sector in sub-Saharan Africa: a systematic review |
title_fullStr | Improving social accountability processes in the health sector in sub-Saharan Africa: a systematic review |
title_full_unstemmed | Improving social accountability processes in the health sector in sub-Saharan Africa: a systematic review |
title_short | Improving social accountability processes in the health sector in sub-Saharan Africa: a systematic review |
title_sort | improving social accountability processes in the health sector in sub-saharan africa: a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5899409/ https://www.ncbi.nlm.nih.gov/pubmed/29653531 http://dx.doi.org/10.1186/s12889-018-5407-8 |
work_keys_str_mv | AT danhoundogeorges improvingsocialaccountabilityprocessesinthehealthsectorinsubsaharanafricaasystematicreview AT nasirikhalidha improvingsocialaccountabilityprocessesinthehealthsectorinsubsaharanafricaasystematicreview AT wiktorowiczmarye improvingsocialaccountabilityprocessesinthehealthsectorinsubsaharanafricaasystematicreview |