Cargando…

Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa—a systematic review protocol

BACKGROUND: Nearly 15% of all pregnancies end in fatal perinatal obstetric complications including bleeding, infections, hypertension, obstructed labor, and complications of abortion. Between 1990 and 2015, an estimated 10.7 million women died due to obstetric complications. Almost all of these deat...

Descripción completa

Detalles Bibliográficos
Autores principales: Geleto, Ayele, Chojenta, Catherine, Mussa, Abdulbasit, Loxton, Deborah
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5902829/
https://www.ncbi.nlm.nih.gov/pubmed/29661217
http://dx.doi.org/10.1186/s13643-018-0720-y
_version_ 1783314820768989184
author Geleto, Ayele
Chojenta, Catherine
Mussa, Abdulbasit
Loxton, Deborah
author_facet Geleto, Ayele
Chojenta, Catherine
Mussa, Abdulbasit
Loxton, Deborah
author_sort Geleto, Ayele
collection PubMed
description BACKGROUND: Nearly 15% of all pregnancies end in fatal perinatal obstetric complications including bleeding, infections, hypertension, obstructed labor, and complications of abortion. Between 1990 and 2015, an estimated 10.7 million women died due to obstetric complications. Almost all of these deaths (99%) happened in developing countries, and 66% of maternal deaths were attributed to sub-Saharan Africa. The majority of cases of maternal mortalities can be prevented through provision of evidence-based potentially life-saving signal functions of emergency obstetric care. However, different factors can hinder women’s ability to access and use emergency obstetric services in sub-Saharan Africa. Therefore, the aim of this review is to synthesize current evidence on barriers to accessing and utilizing emergency obstetric care in sub-Saharan African. Decision-makers and policy formulators will use evidence generated from this review in improving maternal healthcare particularly the emergency obstetric care. METHODS: Electronic databases including MEDLINE, CINAHL, Embase, and Maternity and Infant Care will be searched for studies using predefined search terms. Articles published in English language between 2010 and 2017 with quantitative and qualitative design will be included. The identified papers will be assessed for meeting eligibility criteria. First, the articles will be screened by examining their titles and abstracts. Then, two reviewers will review the full text of the selected articles independently. Two reviewers using a standard data extraction format will undertake data extraction from the retained studies. The quality of the included papers will be assessed using the mixed methods appraisal tool. Results from the eligible studies will be qualitatively synthesized using the narrative synthesis approach and reported using the three delays model. The Preferred Reporting Items for Systematic Reviews and Meta-Analyses checklist will be employed to present the findings. DISCUSSION: This systematic review will present a detailed synthesis of the evidence for barriers to access and utilization of emergency obstetric care in sub-Saharan Africa over the last 7 years. This systematic review is expected to provide clear information that can help in designing maternal health policy and interventions particularly in emergency obstetric care in sub-Saharan Africa where maternal mortality remains high. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42017074102. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13643-018-0720-y) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5902829
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-59028292018-04-23 Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa—a systematic review protocol Geleto, Ayele Chojenta, Catherine Mussa, Abdulbasit Loxton, Deborah Syst Rev Protocol BACKGROUND: Nearly 15% of all pregnancies end in fatal perinatal obstetric complications including bleeding, infections, hypertension, obstructed labor, and complications of abortion. Between 1990 and 2015, an estimated 10.7 million women died due to obstetric complications. Almost all of these deaths (99%) happened in developing countries, and 66% of maternal deaths were attributed to sub-Saharan Africa. The majority of cases of maternal mortalities can be prevented through provision of evidence-based potentially life-saving signal functions of emergency obstetric care. However, different factors can hinder women’s ability to access and use emergency obstetric services in sub-Saharan Africa. Therefore, the aim of this review is to synthesize current evidence on barriers to accessing and utilizing emergency obstetric care in sub-Saharan African. Decision-makers and policy formulators will use evidence generated from this review in improving maternal healthcare particularly the emergency obstetric care. METHODS: Electronic databases including MEDLINE, CINAHL, Embase, and Maternity and Infant Care will be searched for studies using predefined search terms. Articles published in English language between 2010 and 2017 with quantitative and qualitative design will be included. The identified papers will be assessed for meeting eligibility criteria. First, the articles will be screened by examining their titles and abstracts. Then, two reviewers will review the full text of the selected articles independently. Two reviewers using a standard data extraction format will undertake data extraction from the retained studies. The quality of the included papers will be assessed using the mixed methods appraisal tool. Results from the eligible studies will be qualitatively synthesized using the narrative synthesis approach and reported using the three delays model. The Preferred Reporting Items for Systematic Reviews and Meta-Analyses checklist will be employed to present the findings. DISCUSSION: This systematic review will present a detailed synthesis of the evidence for barriers to access and utilization of emergency obstetric care in sub-Saharan Africa over the last 7 years. This systematic review is expected to provide clear information that can help in designing maternal health policy and interventions particularly in emergency obstetric care in sub-Saharan Africa where maternal mortality remains high. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42017074102. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13643-018-0720-y) contains supplementary material, which is available to authorized users. BioMed Central 2018-04-16 /pmc/articles/PMC5902829/ /pubmed/29661217 http://dx.doi.org/10.1186/s13643-018-0720-y Text en © The Author(s). 2018 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Protocol
Geleto, Ayele
Chojenta, Catherine
Mussa, Abdulbasit
Loxton, Deborah
Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa—a systematic review protocol
title Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa—a systematic review protocol
title_full Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa—a systematic review protocol
title_fullStr Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa—a systematic review protocol
title_full_unstemmed Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa—a systematic review protocol
title_short Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa—a systematic review protocol
title_sort barriers to access and utilization of emergency obstetric care at health facilities in sub-saharan africa—a systematic review protocol
topic Protocol
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5902829/
https://www.ncbi.nlm.nih.gov/pubmed/29661217
http://dx.doi.org/10.1186/s13643-018-0720-y
work_keys_str_mv AT geletoayele barrierstoaccessandutilizationofemergencyobstetriccareathealthfacilitiesinsubsaharanafricaasystematicreviewprotocol
AT chojentacatherine barrierstoaccessandutilizationofemergencyobstetriccareathealthfacilitiesinsubsaharanafricaasystematicreviewprotocol
AT mussaabdulbasit barrierstoaccessandutilizationofemergencyobstetriccareathealthfacilitiesinsubsaharanafricaasystematicreviewprotocol
AT loxtondeborah barrierstoaccessandutilizationofemergencyobstetriccareathealthfacilitiesinsubsaharanafricaasystematicreviewprotocol