Cargando…

Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma

Adenoid cystic carcinoma (AdCC), one of the most common salivary gland carcinomas, usually has a fatal outcome. Epidermal growth factor receptor (EGFR) pathway gene mutations are important in predicting a patient's prognosis and estimating the efficacy of molecular therapy targeting the EGFR pa...

Descripción completa

Detalles Bibliográficos
Autores principales: Saida, Kosuke, Murase, Takayuki, Ito, Mayuko, Fujii, Kana, Takino, Hisashi, Masaki, Ayako, Kawakita, Daisuke, Ijichi, Kei, Tada, Yuichiro, Kusafuka, Kimihide, Iida, Yoshiyuki, Onitsuka, Tetsuro, Yatabe, Yasushi, Hanai, Nobuhiro, Hasegawa, Yasuhisa, Shinomiya, Hitomi, Nibu, Ken-Ichi, Shimozato, Kazuo, Inagaki, Hiroshi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Impact Journals LLC 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5908304/
https://www.ncbi.nlm.nih.gov/pubmed/29682203
http://dx.doi.org/10.18632/oncotarget.24818
_version_ 1783315697666883584
author Saida, Kosuke
Murase, Takayuki
Ito, Mayuko
Fujii, Kana
Takino, Hisashi
Masaki, Ayako
Kawakita, Daisuke
Ijichi, Kei
Tada, Yuichiro
Kusafuka, Kimihide
Iida, Yoshiyuki
Onitsuka, Tetsuro
Yatabe, Yasushi
Hanai, Nobuhiro
Hasegawa, Yasuhisa
Shinomiya, Hitomi
Nibu, Ken-Ichi
Shimozato, Kazuo
Inagaki, Hiroshi
author_facet Saida, Kosuke
Murase, Takayuki
Ito, Mayuko
Fujii, Kana
Takino, Hisashi
Masaki, Ayako
Kawakita, Daisuke
Ijichi, Kei
Tada, Yuichiro
Kusafuka, Kimihide
Iida, Yoshiyuki
Onitsuka, Tetsuro
Yatabe, Yasushi
Hanai, Nobuhiro
Hasegawa, Yasuhisa
Shinomiya, Hitomi
Nibu, Ken-Ichi
Shimozato, Kazuo
Inagaki, Hiroshi
author_sort Saida, Kosuke
collection PubMed
description Adenoid cystic carcinoma (AdCC), one of the most common salivary gland carcinomas, usually has a fatal outcome. Epidermal growth factor receptor (EGFR) pathway gene mutations are important in predicting a patient's prognosis and estimating the efficacy of molecular therapy targeting the EGFR pathway. In this study of salivary gland AdCC (SAdCC), we looked for gene mutations in EGFR, RAS family (KRAS, HRAS, and NRAS), PIK3CA, BRAF, and AKT1, using a highly sensitive single-base extension multiplex assay, SNaPshot. Out of 70 cases, EGFR pathway missense mutations were found in 13 (18.6%): RAS mutations in 10 (14.3%), EGFR in one (1.4%), and PIK3CA in 5 (7.1%). None of the cases showed an EGFR deletion by direct sequencing. Concurrent gene mutations were found in three cases (4.3%). EGFR pathway mutations were significantly associated with a shorter disease-free (p = 0.011) and overall survival (p = 0.049) and RAS mutations were as well; (p = 0.010) and (p = 0.024), respectively. The gene fusion status as determined by a FISH assay had no significant association with mutations of the genes involved in the EGFR pathway. In conclusion, EGFR pathway mutations, especially RAS mutations, may be frequent in SAdCC, and associated with a poor prognosis for the patient.
format Online
Article
Text
id pubmed-5908304
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Impact Journals LLC
record_format MEDLINE/PubMed
spelling pubmed-59083042018-04-20 Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma Saida, Kosuke Murase, Takayuki Ito, Mayuko Fujii, Kana Takino, Hisashi Masaki, Ayako Kawakita, Daisuke Ijichi, Kei Tada, Yuichiro Kusafuka, Kimihide Iida, Yoshiyuki Onitsuka, Tetsuro Yatabe, Yasushi Hanai, Nobuhiro Hasegawa, Yasuhisa Shinomiya, Hitomi Nibu, Ken-Ichi Shimozato, Kazuo Inagaki, Hiroshi Oncotarget Research Paper Adenoid cystic carcinoma (AdCC), one of the most common salivary gland carcinomas, usually has a fatal outcome. Epidermal growth factor receptor (EGFR) pathway gene mutations are important in predicting a patient's prognosis and estimating the efficacy of molecular therapy targeting the EGFR pathway. In this study of salivary gland AdCC (SAdCC), we looked for gene mutations in EGFR, RAS family (KRAS, HRAS, and NRAS), PIK3CA, BRAF, and AKT1, using a highly sensitive single-base extension multiplex assay, SNaPshot. Out of 70 cases, EGFR pathway missense mutations were found in 13 (18.6%): RAS mutations in 10 (14.3%), EGFR in one (1.4%), and PIK3CA in 5 (7.1%). None of the cases showed an EGFR deletion by direct sequencing. Concurrent gene mutations were found in three cases (4.3%). EGFR pathway mutations were significantly associated with a shorter disease-free (p = 0.011) and overall survival (p = 0.049) and RAS mutations were as well; (p = 0.010) and (p = 0.024), respectively. The gene fusion status as determined by a FISH assay had no significant association with mutations of the genes involved in the EGFR pathway. In conclusion, EGFR pathway mutations, especially RAS mutations, may be frequent in SAdCC, and associated with a poor prognosis for the patient. Impact Journals LLC 2018-03-30 /pmc/articles/PMC5908304/ /pubmed/29682203 http://dx.doi.org/10.18632/oncotarget.24818 Text en Copyright: © 2018 Saida et al. http://creativecommons.org/licenses/by/3.0/ This article is distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/3.0/) (CC-BY), which permits unrestricted use and redistribution provided that the original author and source are credited.
spellingShingle Research Paper
Saida, Kosuke
Murase, Takayuki
Ito, Mayuko
Fujii, Kana
Takino, Hisashi
Masaki, Ayako
Kawakita, Daisuke
Ijichi, Kei
Tada, Yuichiro
Kusafuka, Kimihide
Iida, Yoshiyuki
Onitsuka, Tetsuro
Yatabe, Yasushi
Hanai, Nobuhiro
Hasegawa, Yasuhisa
Shinomiya, Hitomi
Nibu, Ken-Ichi
Shimozato, Kazuo
Inagaki, Hiroshi
Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma
title Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma
title_full Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma
title_fullStr Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma
title_full_unstemmed Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma
title_short Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma
title_sort mutation analysis of the egfr pathway genes, egfr, ras, pik3ca, braf, and akt1, in salivary gland adenoid cystic carcinoma
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5908304/
https://www.ncbi.nlm.nih.gov/pubmed/29682203
http://dx.doi.org/10.18632/oncotarget.24818
work_keys_str_mv AT saidakosuke mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT murasetakayuki mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT itomayuko mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT fujiikana mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT takinohisashi mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT masakiayako mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT kawakitadaisuke mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT ijichikei mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT tadayuichiro mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT kusafukakimihide mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT iidayoshiyuki mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT onitsukatetsuro mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT yatabeyasushi mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT hanainobuhiro mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT hasegawayasuhisa mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT shinomiyahitomi mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT nibukenichi mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT shimozatokazuo mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma
AT inagakihiroshi mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma