Cargando…
Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma
Adenoid cystic carcinoma (AdCC), one of the most common salivary gland carcinomas, usually has a fatal outcome. Epidermal growth factor receptor (EGFR) pathway gene mutations are important in predicting a patient's prognosis and estimating the efficacy of molecular therapy targeting the EGFR pa...
Autores principales: | , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Impact Journals LLC
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5908304/ https://www.ncbi.nlm.nih.gov/pubmed/29682203 http://dx.doi.org/10.18632/oncotarget.24818 |
_version_ | 1783315697666883584 |
---|---|
author | Saida, Kosuke Murase, Takayuki Ito, Mayuko Fujii, Kana Takino, Hisashi Masaki, Ayako Kawakita, Daisuke Ijichi, Kei Tada, Yuichiro Kusafuka, Kimihide Iida, Yoshiyuki Onitsuka, Tetsuro Yatabe, Yasushi Hanai, Nobuhiro Hasegawa, Yasuhisa Shinomiya, Hitomi Nibu, Ken-Ichi Shimozato, Kazuo Inagaki, Hiroshi |
author_facet | Saida, Kosuke Murase, Takayuki Ito, Mayuko Fujii, Kana Takino, Hisashi Masaki, Ayako Kawakita, Daisuke Ijichi, Kei Tada, Yuichiro Kusafuka, Kimihide Iida, Yoshiyuki Onitsuka, Tetsuro Yatabe, Yasushi Hanai, Nobuhiro Hasegawa, Yasuhisa Shinomiya, Hitomi Nibu, Ken-Ichi Shimozato, Kazuo Inagaki, Hiroshi |
author_sort | Saida, Kosuke |
collection | PubMed |
description | Adenoid cystic carcinoma (AdCC), one of the most common salivary gland carcinomas, usually has a fatal outcome. Epidermal growth factor receptor (EGFR) pathway gene mutations are important in predicting a patient's prognosis and estimating the efficacy of molecular therapy targeting the EGFR pathway. In this study of salivary gland AdCC (SAdCC), we looked for gene mutations in EGFR, RAS family (KRAS, HRAS, and NRAS), PIK3CA, BRAF, and AKT1, using a highly sensitive single-base extension multiplex assay, SNaPshot. Out of 70 cases, EGFR pathway missense mutations were found in 13 (18.6%): RAS mutations in 10 (14.3%), EGFR in one (1.4%), and PIK3CA in 5 (7.1%). None of the cases showed an EGFR deletion by direct sequencing. Concurrent gene mutations were found in three cases (4.3%). EGFR pathway mutations were significantly associated with a shorter disease-free (p = 0.011) and overall survival (p = 0.049) and RAS mutations were as well; (p = 0.010) and (p = 0.024), respectively. The gene fusion status as determined by a FISH assay had no significant association with mutations of the genes involved in the EGFR pathway. In conclusion, EGFR pathway mutations, especially RAS mutations, may be frequent in SAdCC, and associated with a poor prognosis for the patient. |
format | Online Article Text |
id | pubmed-5908304 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Impact Journals LLC |
record_format | MEDLINE/PubMed |
spelling | pubmed-59083042018-04-20 Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma Saida, Kosuke Murase, Takayuki Ito, Mayuko Fujii, Kana Takino, Hisashi Masaki, Ayako Kawakita, Daisuke Ijichi, Kei Tada, Yuichiro Kusafuka, Kimihide Iida, Yoshiyuki Onitsuka, Tetsuro Yatabe, Yasushi Hanai, Nobuhiro Hasegawa, Yasuhisa Shinomiya, Hitomi Nibu, Ken-Ichi Shimozato, Kazuo Inagaki, Hiroshi Oncotarget Research Paper Adenoid cystic carcinoma (AdCC), one of the most common salivary gland carcinomas, usually has a fatal outcome. Epidermal growth factor receptor (EGFR) pathway gene mutations are important in predicting a patient's prognosis and estimating the efficacy of molecular therapy targeting the EGFR pathway. In this study of salivary gland AdCC (SAdCC), we looked for gene mutations in EGFR, RAS family (KRAS, HRAS, and NRAS), PIK3CA, BRAF, and AKT1, using a highly sensitive single-base extension multiplex assay, SNaPshot. Out of 70 cases, EGFR pathway missense mutations were found in 13 (18.6%): RAS mutations in 10 (14.3%), EGFR in one (1.4%), and PIK3CA in 5 (7.1%). None of the cases showed an EGFR deletion by direct sequencing. Concurrent gene mutations were found in three cases (4.3%). EGFR pathway mutations were significantly associated with a shorter disease-free (p = 0.011) and overall survival (p = 0.049) and RAS mutations were as well; (p = 0.010) and (p = 0.024), respectively. The gene fusion status as determined by a FISH assay had no significant association with mutations of the genes involved in the EGFR pathway. In conclusion, EGFR pathway mutations, especially RAS mutations, may be frequent in SAdCC, and associated with a poor prognosis for the patient. Impact Journals LLC 2018-03-30 /pmc/articles/PMC5908304/ /pubmed/29682203 http://dx.doi.org/10.18632/oncotarget.24818 Text en Copyright: © 2018 Saida et al. http://creativecommons.org/licenses/by/3.0/ This article is distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/3.0/) (CC-BY), which permits unrestricted use and redistribution provided that the original author and source are credited. |
spellingShingle | Research Paper Saida, Kosuke Murase, Takayuki Ito, Mayuko Fujii, Kana Takino, Hisashi Masaki, Ayako Kawakita, Daisuke Ijichi, Kei Tada, Yuichiro Kusafuka, Kimihide Iida, Yoshiyuki Onitsuka, Tetsuro Yatabe, Yasushi Hanai, Nobuhiro Hasegawa, Yasuhisa Shinomiya, Hitomi Nibu, Ken-Ichi Shimozato, Kazuo Inagaki, Hiroshi Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma |
title | Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma |
title_full | Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma |
title_fullStr | Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma |
title_full_unstemmed | Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma |
title_short | Mutation analysis of the EGFR pathway genes, EGFR, RAS, PIK3CA, BRAF, and AKT1, in salivary gland adenoid cystic carcinoma |
title_sort | mutation analysis of the egfr pathway genes, egfr, ras, pik3ca, braf, and akt1, in salivary gland adenoid cystic carcinoma |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5908304/ https://www.ncbi.nlm.nih.gov/pubmed/29682203 http://dx.doi.org/10.18632/oncotarget.24818 |
work_keys_str_mv | AT saidakosuke mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT murasetakayuki mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT itomayuko mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT fujiikana mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT takinohisashi mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT masakiayako mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT kawakitadaisuke mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT ijichikei mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT tadayuichiro mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT kusafukakimihide mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT iidayoshiyuki mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT onitsukatetsuro mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT yatabeyasushi mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT hanainobuhiro mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT hasegawayasuhisa mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT shinomiyahitomi mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT nibukenichi mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT shimozatokazuo mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma AT inagakihiroshi mutationanalysisoftheegfrpathwaygenesegfrraspik3cabrafandakt1insalivaryglandadenoidcysticcarcinoma |