Cargando…

Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder

We examined the activity of spermidine/spermine N(1)‐acetyltransferase (SAT), a rate‐limiting enzyme of the biodegradation of polyamines, in N‐butyl‐N‐(4–hydroxybutyI)nitrosamine‐induced transitional cell carcinoma (TCC) and melamine‐induced papillomatosis of rat bladder, and compared the activity t...

Descripción completa

Detalles Bibliográficos
Autores principales: Matsui‐Yuasa, Isao, Otani, Shuzo, Yano, Yoshihisa, Takada, Nobuyasu, Shibata, Masa‐Aki, Fukushima, Shoji
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Blackwell Publishing Ltd 1992
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5918678/
https://www.ncbi.nlm.nih.gov/pubmed/1360468
http://dx.doi.org/10.1111/j.1349-7006.1992.tb02718.x
_version_ 1783317469470916608
author Matsui‐Yuasa, Isao
Otani, Shuzo
Yano, Yoshihisa
Takada, Nobuyasu
Shibata, Masa‐Aki
Fukushima, Shoji
author_facet Matsui‐Yuasa, Isao
Otani, Shuzo
Yano, Yoshihisa
Takada, Nobuyasu
Shibata, Masa‐Aki
Fukushima, Shoji
author_sort Matsui‐Yuasa, Isao
collection PubMed
description We examined the activity of spermidine/spermine N(1)‐acetyltransferase (SAT), a rate‐limiting enzyme of the biodegradation of polyamines, in N‐butyl‐N‐(4–hydroxybutyI)nitrosamine‐induced transitional cell carcinoma (TCC) and melamine‐induced papillomatosis of rat bladder, and compared the activity to that of ornithine decarboxylase (ODC). Both activities were higher in both lesions than in control rats. The difference between SAT and ODC activities in cancerous tissue and papillomatosis was not significant. Cells stained for proliferating cell nuclear antigen (PCNA) were abundant in papillomatosis. TCC had areas with much PCNA. The results indicated that an elevation of SAT activity occurs in both reversible and irreversible proliferation of bladder epithelium and could be important in bladder carcinogenesis.
format Online
Article
Text
id pubmed-5918678
institution National Center for Biotechnology Information
language English
publishDate 1992
publisher Blackwell Publishing Ltd
record_format MEDLINE/PubMed
spelling pubmed-59186782018-05-11 Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder Matsui‐Yuasa, Isao Otani, Shuzo Yano, Yoshihisa Takada, Nobuyasu Shibata, Masa‐Aki Fukushima, Shoji Jpn J Cancer Res Rapid Communication We examined the activity of spermidine/spermine N(1)‐acetyltransferase (SAT), a rate‐limiting enzyme of the biodegradation of polyamines, in N‐butyl‐N‐(4–hydroxybutyI)nitrosamine‐induced transitional cell carcinoma (TCC) and melamine‐induced papillomatosis of rat bladder, and compared the activity to that of ornithine decarboxylase (ODC). Both activities were higher in both lesions than in control rats. The difference between SAT and ODC activities in cancerous tissue and papillomatosis was not significant. Cells stained for proliferating cell nuclear antigen (PCNA) were abundant in papillomatosis. TCC had areas with much PCNA. The results indicated that an elevation of SAT activity occurs in both reversible and irreversible proliferation of bladder epithelium and could be important in bladder carcinogenesis. Blackwell Publishing Ltd 1992-10 /pmc/articles/PMC5918678/ /pubmed/1360468 http://dx.doi.org/10.1111/j.1349-7006.1992.tb02718.x Text en
spellingShingle Rapid Communication
Matsui‐Yuasa, Isao
Otani, Shuzo
Yano, Yoshihisa
Takada, Nobuyasu
Shibata, Masa‐Aki
Fukushima, Shoji
Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder
title Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder
title_full Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder
title_fullStr Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder
title_full_unstemmed Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder
title_short Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder
title_sort spermidine/spermine n‐acetyltransferase, a new biochemical marker for epithelial proliferation in rat bladder
topic Rapid Communication
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5918678/
https://www.ncbi.nlm.nih.gov/pubmed/1360468
http://dx.doi.org/10.1111/j.1349-7006.1992.tb02718.x
work_keys_str_mv AT matsuiyuasaisao spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder
AT otanishuzo spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder
AT yanoyoshihisa spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder
AT takadanobuyasu spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder
AT shibatamasaaki spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder
AT fukushimashoji spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder