Cargando…
Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder
We examined the activity of spermidine/spermine N(1)‐acetyltransferase (SAT), a rate‐limiting enzyme of the biodegradation of polyamines, in N‐butyl‐N‐(4–hydroxybutyI)nitrosamine‐induced transitional cell carcinoma (TCC) and melamine‐induced papillomatosis of rat bladder, and compared the activity t...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Blackwell Publishing Ltd
1992
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5918678/ https://www.ncbi.nlm.nih.gov/pubmed/1360468 http://dx.doi.org/10.1111/j.1349-7006.1992.tb02718.x |
_version_ | 1783317469470916608 |
---|---|
author | Matsui‐Yuasa, Isao Otani, Shuzo Yano, Yoshihisa Takada, Nobuyasu Shibata, Masa‐Aki Fukushima, Shoji |
author_facet | Matsui‐Yuasa, Isao Otani, Shuzo Yano, Yoshihisa Takada, Nobuyasu Shibata, Masa‐Aki Fukushima, Shoji |
author_sort | Matsui‐Yuasa, Isao |
collection | PubMed |
description | We examined the activity of spermidine/spermine N(1)‐acetyltransferase (SAT), a rate‐limiting enzyme of the biodegradation of polyamines, in N‐butyl‐N‐(4–hydroxybutyI)nitrosamine‐induced transitional cell carcinoma (TCC) and melamine‐induced papillomatosis of rat bladder, and compared the activity to that of ornithine decarboxylase (ODC). Both activities were higher in both lesions than in control rats. The difference between SAT and ODC activities in cancerous tissue and papillomatosis was not significant. Cells stained for proliferating cell nuclear antigen (PCNA) were abundant in papillomatosis. TCC had areas with much PCNA. The results indicated that an elevation of SAT activity occurs in both reversible and irreversible proliferation of bladder epithelium and could be important in bladder carcinogenesis. |
format | Online Article Text |
id | pubmed-5918678 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 1992 |
publisher | Blackwell Publishing Ltd |
record_format | MEDLINE/PubMed |
spelling | pubmed-59186782018-05-11 Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder Matsui‐Yuasa, Isao Otani, Shuzo Yano, Yoshihisa Takada, Nobuyasu Shibata, Masa‐Aki Fukushima, Shoji Jpn J Cancer Res Rapid Communication We examined the activity of spermidine/spermine N(1)‐acetyltransferase (SAT), a rate‐limiting enzyme of the biodegradation of polyamines, in N‐butyl‐N‐(4–hydroxybutyI)nitrosamine‐induced transitional cell carcinoma (TCC) and melamine‐induced papillomatosis of rat bladder, and compared the activity to that of ornithine decarboxylase (ODC). Both activities were higher in both lesions than in control rats. The difference between SAT and ODC activities in cancerous tissue and papillomatosis was not significant. Cells stained for proliferating cell nuclear antigen (PCNA) were abundant in papillomatosis. TCC had areas with much PCNA. The results indicated that an elevation of SAT activity occurs in both reversible and irreversible proliferation of bladder epithelium and could be important in bladder carcinogenesis. Blackwell Publishing Ltd 1992-10 /pmc/articles/PMC5918678/ /pubmed/1360468 http://dx.doi.org/10.1111/j.1349-7006.1992.tb02718.x Text en |
spellingShingle | Rapid Communication Matsui‐Yuasa, Isao Otani, Shuzo Yano, Yoshihisa Takada, Nobuyasu Shibata, Masa‐Aki Fukushima, Shoji Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder |
title | Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder |
title_full | Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder |
title_fullStr | Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder |
title_full_unstemmed | Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder |
title_short | Spermidine/Spermine N‐Acetyltransferase, a New Biochemical Marker for Epithelial Proliferation in Rat Bladder |
title_sort | spermidine/spermine n‐acetyltransferase, a new biochemical marker for epithelial proliferation in rat bladder |
topic | Rapid Communication |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5918678/ https://www.ncbi.nlm.nih.gov/pubmed/1360468 http://dx.doi.org/10.1111/j.1349-7006.1992.tb02718.x |
work_keys_str_mv | AT matsuiyuasaisao spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder AT otanishuzo spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder AT yanoyoshihisa spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder AT takadanobuyasu spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder AT shibatamasaaki spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder AT fukushimashoji spermidinesperminenacetyltransferaseanewbiochemicalmarkerforepithelialproliferationinratbladder |