Cargando…

Update on the proteomics of male infertility: A systematic review

OBJECTIVE: To assess the role of differentially expressed proteins as a resource for potential biomarker identification of infertility, as male infertility is of rising concern in reproductive medicine and evidence pertaining to its aetiology at a molecular level particularly proteomic as spermatozo...

Descripción completa

Detalles Bibliográficos
Autores principales: Panner Selvam, Manesh Kumar, Agarwal, Ashok
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5922221/
https://www.ncbi.nlm.nih.gov/pubmed/29713541
http://dx.doi.org/10.1016/j.aju.2017.11.016
_version_ 1783318163284295680
author Panner Selvam, Manesh Kumar
Agarwal, Ashok
author_facet Panner Selvam, Manesh Kumar
Agarwal, Ashok
author_sort Panner Selvam, Manesh Kumar
collection PubMed
description OBJECTIVE: To assess the role of differentially expressed proteins as a resource for potential biomarker identification of infertility, as male infertility is of rising concern in reproductive medicine and evidence pertaining to its aetiology at a molecular level particularly proteomic as spermatozoa lack transcription and translation. Proteomics is considered as a major field in molecular biology to validate the target proteins in a pathophysiological state. Differential expression analysis of sperm proteins in infertile men and bioinformatics analysis offer information about their involvement in biological pathways. MATERIALS AND METHODS: Literature search was performed on PubMed, Medline, and Science Direct databases using the keywords ‘sperm proteomics’ and ‘male infertility’. We also reviewed the relevant cross references of retrieved articles and included them in the review process. Articles written in any language other than English were excluded. RESULTS: Of 575 articles identified, preliminary screening for relevant studies eliminated 293 articles. At the next level of selection, from 282 studies only 80 articles related to male infertility condition met the selection criteria and were included in this review. CONCLUSION: In this molecular era, sperm proteomics has created a platform for enhanced understanding of male reproductive physiology as a potential tool for identification of novel protein biomarkers related to sperm function in infertile men. Therefore, it is believed that proteomic biomarkers can overcome the gaps in information from conventional semen analysis that are of limited clinical utility.
format Online
Article
Text
id pubmed-5922221
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-59222212018-04-30 Update on the proteomics of male infertility: A systematic review Panner Selvam, Manesh Kumar Agarwal, Ashok Arab J Urol Diagnosis OBJECTIVE: To assess the role of differentially expressed proteins as a resource for potential biomarker identification of infertility, as male infertility is of rising concern in reproductive medicine and evidence pertaining to its aetiology at a molecular level particularly proteomic as spermatozoa lack transcription and translation. Proteomics is considered as a major field in molecular biology to validate the target proteins in a pathophysiological state. Differential expression analysis of sperm proteins in infertile men and bioinformatics analysis offer information about their involvement in biological pathways. MATERIALS AND METHODS: Literature search was performed on PubMed, Medline, and Science Direct databases using the keywords ‘sperm proteomics’ and ‘male infertility’. We also reviewed the relevant cross references of retrieved articles and included them in the review process. Articles written in any language other than English were excluded. RESULTS: Of 575 articles identified, preliminary screening for relevant studies eliminated 293 articles. At the next level of selection, from 282 studies only 80 articles related to male infertility condition met the selection criteria and were included in this review. CONCLUSION: In this molecular era, sperm proteomics has created a platform for enhanced understanding of male reproductive physiology as a potential tool for identification of novel protein biomarkers related to sperm function in infertile men. Therefore, it is believed that proteomic biomarkers can overcome the gaps in information from conventional semen analysis that are of limited clinical utility. Elsevier 2017-12-29 /pmc/articles/PMC5922221/ /pubmed/29713541 http://dx.doi.org/10.1016/j.aju.2017.11.016 Text en © 2017 Production and hosting by Elsevier B.V. on behalf of Arab Association of Urology. http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Diagnosis
Panner Selvam, Manesh Kumar
Agarwal, Ashok
Update on the proteomics of male infertility: A systematic review
title Update on the proteomics of male infertility: A systematic review
title_full Update on the proteomics of male infertility: A systematic review
title_fullStr Update on the proteomics of male infertility: A systematic review
title_full_unstemmed Update on the proteomics of male infertility: A systematic review
title_short Update on the proteomics of male infertility: A systematic review
title_sort update on the proteomics of male infertility: a systematic review
topic Diagnosis
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5922221/
https://www.ncbi.nlm.nih.gov/pubmed/29713541
http://dx.doi.org/10.1016/j.aju.2017.11.016
work_keys_str_mv AT pannerselvammaneshkumar updateontheproteomicsofmaleinfertilityasystematicreview
AT agarwalashok updateontheproteomicsofmaleinfertilityasystematicreview