Cargando…
Update on the proteomics of male infertility: A systematic review
OBJECTIVE: To assess the role of differentially expressed proteins as a resource for potential biomarker identification of infertility, as male infertility is of rising concern in reproductive medicine and evidence pertaining to its aetiology at a molecular level particularly proteomic as spermatozo...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5922221/ https://www.ncbi.nlm.nih.gov/pubmed/29713541 http://dx.doi.org/10.1016/j.aju.2017.11.016 |
_version_ | 1783318163284295680 |
---|---|
author | Panner Selvam, Manesh Kumar Agarwal, Ashok |
author_facet | Panner Selvam, Manesh Kumar Agarwal, Ashok |
author_sort | Panner Selvam, Manesh Kumar |
collection | PubMed |
description | OBJECTIVE: To assess the role of differentially expressed proteins as a resource for potential biomarker identification of infertility, as male infertility is of rising concern in reproductive medicine and evidence pertaining to its aetiology at a molecular level particularly proteomic as spermatozoa lack transcription and translation. Proteomics is considered as a major field in molecular biology to validate the target proteins in a pathophysiological state. Differential expression analysis of sperm proteins in infertile men and bioinformatics analysis offer information about their involvement in biological pathways. MATERIALS AND METHODS: Literature search was performed on PubMed, Medline, and Science Direct databases using the keywords ‘sperm proteomics’ and ‘male infertility’. We also reviewed the relevant cross references of retrieved articles and included them in the review process. Articles written in any language other than English were excluded. RESULTS: Of 575 articles identified, preliminary screening for relevant studies eliminated 293 articles. At the next level of selection, from 282 studies only 80 articles related to male infertility condition met the selection criteria and were included in this review. CONCLUSION: In this molecular era, sperm proteomics has created a platform for enhanced understanding of male reproductive physiology as a potential tool for identification of novel protein biomarkers related to sperm function in infertile men. Therefore, it is believed that proteomic biomarkers can overcome the gaps in information from conventional semen analysis that are of limited clinical utility. |
format | Online Article Text |
id | pubmed-5922221 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Elsevier |
record_format | MEDLINE/PubMed |
spelling | pubmed-59222212018-04-30 Update on the proteomics of male infertility: A systematic review Panner Selvam, Manesh Kumar Agarwal, Ashok Arab J Urol Diagnosis OBJECTIVE: To assess the role of differentially expressed proteins as a resource for potential biomarker identification of infertility, as male infertility is of rising concern in reproductive medicine and evidence pertaining to its aetiology at a molecular level particularly proteomic as spermatozoa lack transcription and translation. Proteomics is considered as a major field in molecular biology to validate the target proteins in a pathophysiological state. Differential expression analysis of sperm proteins in infertile men and bioinformatics analysis offer information about their involvement in biological pathways. MATERIALS AND METHODS: Literature search was performed on PubMed, Medline, and Science Direct databases using the keywords ‘sperm proteomics’ and ‘male infertility’. We also reviewed the relevant cross references of retrieved articles and included them in the review process. Articles written in any language other than English were excluded. RESULTS: Of 575 articles identified, preliminary screening for relevant studies eliminated 293 articles. At the next level of selection, from 282 studies only 80 articles related to male infertility condition met the selection criteria and were included in this review. CONCLUSION: In this molecular era, sperm proteomics has created a platform for enhanced understanding of male reproductive physiology as a potential tool for identification of novel protein biomarkers related to sperm function in infertile men. Therefore, it is believed that proteomic biomarkers can overcome the gaps in information from conventional semen analysis that are of limited clinical utility. Elsevier 2017-12-29 /pmc/articles/PMC5922221/ /pubmed/29713541 http://dx.doi.org/10.1016/j.aju.2017.11.016 Text en © 2017 Production and hosting by Elsevier B.V. on behalf of Arab Association of Urology. http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/). |
spellingShingle | Diagnosis Panner Selvam, Manesh Kumar Agarwal, Ashok Update on the proteomics of male infertility: A systematic review |
title | Update on the proteomics of male infertility: A systematic review |
title_full | Update on the proteomics of male infertility: A systematic review |
title_fullStr | Update on the proteomics of male infertility: A systematic review |
title_full_unstemmed | Update on the proteomics of male infertility: A systematic review |
title_short | Update on the proteomics of male infertility: A systematic review |
title_sort | update on the proteomics of male infertility: a systematic review |
topic | Diagnosis |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5922221/ https://www.ncbi.nlm.nih.gov/pubmed/29713541 http://dx.doi.org/10.1016/j.aju.2017.11.016 |
work_keys_str_mv | AT pannerselvammaneshkumar updateontheproteomicsofmaleinfertilityasystematicreview AT agarwalashok updateontheproteomicsofmaleinfertilityasystematicreview |