Cargando…

Functional Role of Internal and External Visual Imagery: Preliminary Evidences from Pilates

The present study investigates whether a functional difference between the visualization of a sequence of movements in the perspective of the first- (internal VMI-I) or third- (external VMI-E) person exists, which might be relevant to promote learning. By using a mental chronometry experimental para...

Descripción completa

Detalles Bibliográficos
Autores principales: Montuori, Simone, Curcio, Giuseppe, Sorrentino, Pierpaolo, Belloni, Lidia, Sorrentino, Giuseppe, Foti, Francesca, Mandolesi, Laura
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5924993/
https://www.ncbi.nlm.nih.gov/pubmed/29849565
http://dx.doi.org/10.1155/2018/7235872
_version_ 1783318624715407360
author Montuori, Simone
Curcio, Giuseppe
Sorrentino, Pierpaolo
Belloni, Lidia
Sorrentino, Giuseppe
Foti, Francesca
Mandolesi, Laura
author_facet Montuori, Simone
Curcio, Giuseppe
Sorrentino, Pierpaolo
Belloni, Lidia
Sorrentino, Giuseppe
Foti, Francesca
Mandolesi, Laura
author_sort Montuori, Simone
collection PubMed
description The present study investigates whether a functional difference between the visualization of a sequence of movements in the perspective of the first- (internal VMI-I) or third- (external VMI-E) person exists, which might be relevant to promote learning. By using a mental chronometry experimental paradigm, we have compared the time or execution, imagination in the VMI-I perspective, and imagination in the VMI-E perspective of two kinds of Pilates exercises. The analysis was carried out in individuals with different levels of competence (expert, novice, and no-practice individuals). Our results showed that in the Expert group, in the VMI-I perspective, the imagination time was similar to the execution time, while in the VMI-E perspective, the imagination time was significantly lower than the execution time. An opposite pattern was found in the Novice group, in which the time of imagination was similar to that of execution only in the VMI-E perspective, while in the VMI-I perspective, the time of imagination was significantly lower than the time of execution. In the control group, the times of both modalities of imagination were significantly lower than the execution time for each exercise. The present data suggest that, while the VMI-I serves to train an already internalised gesture, the VMI-E perspective could be useful to learn, and then improve, the recently acquired sequence of movements. Moreover, visual imagery is not useful for individuals that lack a specific motor experience. The present data offer new insights in the application of mental training techniques, especially in field of sports. However, further investigations are needed to better understand the functional role of internal and external visual imagery.
format Online
Article
Text
id pubmed-5924993
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Hindawi
record_format MEDLINE/PubMed
spelling pubmed-59249932018-05-30 Functional Role of Internal and External Visual Imagery: Preliminary Evidences from Pilates Montuori, Simone Curcio, Giuseppe Sorrentino, Pierpaolo Belloni, Lidia Sorrentino, Giuseppe Foti, Francesca Mandolesi, Laura Neural Plast Research Article The present study investigates whether a functional difference between the visualization of a sequence of movements in the perspective of the first- (internal VMI-I) or third- (external VMI-E) person exists, which might be relevant to promote learning. By using a mental chronometry experimental paradigm, we have compared the time or execution, imagination in the VMI-I perspective, and imagination in the VMI-E perspective of two kinds of Pilates exercises. The analysis was carried out in individuals with different levels of competence (expert, novice, and no-practice individuals). Our results showed that in the Expert group, in the VMI-I perspective, the imagination time was similar to the execution time, while in the VMI-E perspective, the imagination time was significantly lower than the execution time. An opposite pattern was found in the Novice group, in which the time of imagination was similar to that of execution only in the VMI-E perspective, while in the VMI-I perspective, the time of imagination was significantly lower than the time of execution. In the control group, the times of both modalities of imagination were significantly lower than the execution time for each exercise. The present data suggest that, while the VMI-I serves to train an already internalised gesture, the VMI-E perspective could be useful to learn, and then improve, the recently acquired sequence of movements. Moreover, visual imagery is not useful for individuals that lack a specific motor experience. The present data offer new insights in the application of mental training techniques, especially in field of sports. However, further investigations are needed to better understand the functional role of internal and external visual imagery. Hindawi 2018-04-15 /pmc/articles/PMC5924993/ /pubmed/29849565 http://dx.doi.org/10.1155/2018/7235872 Text en Copyright © 2018 Simone Montuori et al. http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Montuori, Simone
Curcio, Giuseppe
Sorrentino, Pierpaolo
Belloni, Lidia
Sorrentino, Giuseppe
Foti, Francesca
Mandolesi, Laura
Functional Role of Internal and External Visual Imagery: Preliminary Evidences from Pilates
title Functional Role of Internal and External Visual Imagery: Preliminary Evidences from Pilates
title_full Functional Role of Internal and External Visual Imagery: Preliminary Evidences from Pilates
title_fullStr Functional Role of Internal and External Visual Imagery: Preliminary Evidences from Pilates
title_full_unstemmed Functional Role of Internal and External Visual Imagery: Preliminary Evidences from Pilates
title_short Functional Role of Internal and External Visual Imagery: Preliminary Evidences from Pilates
title_sort functional role of internal and external visual imagery: preliminary evidences from pilates
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5924993/
https://www.ncbi.nlm.nih.gov/pubmed/29849565
http://dx.doi.org/10.1155/2018/7235872
work_keys_str_mv AT montuorisimone functionalroleofinternalandexternalvisualimagerypreliminaryevidencesfrompilates
AT curciogiuseppe functionalroleofinternalandexternalvisualimagerypreliminaryevidencesfrompilates
AT sorrentinopierpaolo functionalroleofinternalandexternalvisualimagerypreliminaryevidencesfrompilates
AT bellonilidia functionalroleofinternalandexternalvisualimagerypreliminaryevidencesfrompilates
AT sorrentinogiuseppe functionalroleofinternalandexternalvisualimagerypreliminaryevidencesfrompilates
AT fotifrancesca functionalroleofinternalandexternalvisualimagerypreliminaryevidencesfrompilates
AT mandolesilaura functionalroleofinternalandexternalvisualimagerypreliminaryevidencesfrompilates