Cargando…
Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition
There is growing evidence to suggest that bone marrow‐derived mesenchymal stem cells (BM‐MSCs) are key players in tumour stroma. Here, we investigated the cross‐talk between BM‐MSCs and osteosarcoma (OS) cells. We revealed a strong tropism of BM‐MSCs towards these tumour cells and identified monocyt...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5928379/ https://www.ncbi.nlm.nih.gov/pubmed/29517849 http://dx.doi.org/10.1002/1878-0261.12189 |
_version_ | 1783319233203011584 |
---|---|
author | Pietrovito, Laura Leo, Angela Gori, Valentina Lulli, Matteo Parri, Matteo Becherucci, Valentina Piccini, Luisa Bambi, Franco Taddei, Maria Letizia Chiarugi, Paola |
author_facet | Pietrovito, Laura Leo, Angela Gori, Valentina Lulli, Matteo Parri, Matteo Becherucci, Valentina Piccini, Luisa Bambi, Franco Taddei, Maria Letizia Chiarugi, Paola |
author_sort | Pietrovito, Laura |
collection | PubMed |
description | There is growing evidence to suggest that bone marrow‐derived mesenchymal stem cells (BM‐MSCs) are key players in tumour stroma. Here, we investigated the cross‐talk between BM‐MSCs and osteosarcoma (OS) cells. We revealed a strong tropism of BM‐MSCs towards these tumour cells and identified monocyte chemoattractant protein (MCP)‐1, growth‐regulated oncogene (GRO)‐α and transforming growth factor (TGF)‐β1 as pivotal factors for BM‐MSC chemotaxis. Once in contact with OS cells, BM‐MSCs trans‐differentiate into cancer‐associated fibroblasts, further increasing MCP‐1, GRO‐α, interleukin (IL)‐6 and IL‐8 levels in the tumour microenvironment. These cytokines promote mesenchymal to amoeboid transition (MAT), driven by activation of the small GTPase RhoA, in OS cells, as illustrated by the in vitro assay and live imaging. The outcome is a significant increase of aggressiveness in OS cells in terms of motility, invasiveness and transendothelial migration. In keeping with their enhanced transendothelial migration abilities, OS cells stimulated by BM‐MSCs also sustain migration, invasion and formation of the in vitro capillary network of endothelial cells. Thus, BM‐MSC recruitment to the OS site and the consequent cytokine‐induced MAT are crucial events in OS malignancy. |
format | Online Article Text |
id | pubmed-5928379 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-59283792018-05-07 Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition Pietrovito, Laura Leo, Angela Gori, Valentina Lulli, Matteo Parri, Matteo Becherucci, Valentina Piccini, Luisa Bambi, Franco Taddei, Maria Letizia Chiarugi, Paola Mol Oncol Research Articles There is growing evidence to suggest that bone marrow‐derived mesenchymal stem cells (BM‐MSCs) are key players in tumour stroma. Here, we investigated the cross‐talk between BM‐MSCs and osteosarcoma (OS) cells. We revealed a strong tropism of BM‐MSCs towards these tumour cells and identified monocyte chemoattractant protein (MCP)‐1, growth‐regulated oncogene (GRO)‐α and transforming growth factor (TGF)‐β1 as pivotal factors for BM‐MSC chemotaxis. Once in contact with OS cells, BM‐MSCs trans‐differentiate into cancer‐associated fibroblasts, further increasing MCP‐1, GRO‐α, interleukin (IL)‐6 and IL‐8 levels in the tumour microenvironment. These cytokines promote mesenchymal to amoeboid transition (MAT), driven by activation of the small GTPase RhoA, in OS cells, as illustrated by the in vitro assay and live imaging. The outcome is a significant increase of aggressiveness in OS cells in terms of motility, invasiveness and transendothelial migration. In keeping with their enhanced transendothelial migration abilities, OS cells stimulated by BM‐MSCs also sustain migration, invasion and formation of the in vitro capillary network of endothelial cells. Thus, BM‐MSC recruitment to the OS site and the consequent cytokine‐induced MAT are crucial events in OS malignancy. John Wiley and Sons Inc. 2018-03-31 2018-05 /pmc/articles/PMC5928379/ /pubmed/29517849 http://dx.doi.org/10.1002/1878-0261.12189 Text en © 2018 The Authors. Published by FEBS Press and John Wiley & Sons Ltd. This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Articles Pietrovito, Laura Leo, Angela Gori, Valentina Lulli, Matteo Parri, Matteo Becherucci, Valentina Piccini, Luisa Bambi, Franco Taddei, Maria Letizia Chiarugi, Paola Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition |
title | Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition |
title_full | Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition |
title_fullStr | Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition |
title_full_unstemmed | Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition |
title_short | Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition |
title_sort | bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition |
topic | Research Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5928379/ https://www.ncbi.nlm.nih.gov/pubmed/29517849 http://dx.doi.org/10.1002/1878-0261.12189 |
work_keys_str_mv | AT pietrovitolaura bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition AT leoangela bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition AT gorivalentina bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition AT lullimatteo bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition AT parrimatteo bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition AT becheruccivalentina bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition AT picciniluisa bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition AT bambifranco bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition AT taddeimarialetizia bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition AT chiarugipaola bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition |