Cargando…

Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition

There is growing evidence to suggest that bone marrow‐derived mesenchymal stem cells (BM‐MSCs) are key players in tumour stroma. Here, we investigated the cross‐talk between BM‐MSCs and osteosarcoma (OS) cells. We revealed a strong tropism of BM‐MSCs towards these tumour cells and identified monocyt...

Descripción completa

Detalles Bibliográficos
Autores principales: Pietrovito, Laura, Leo, Angela, Gori, Valentina, Lulli, Matteo, Parri, Matteo, Becherucci, Valentina, Piccini, Luisa, Bambi, Franco, Taddei, Maria Letizia, Chiarugi, Paola
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5928379/
https://www.ncbi.nlm.nih.gov/pubmed/29517849
http://dx.doi.org/10.1002/1878-0261.12189
_version_ 1783319233203011584
author Pietrovito, Laura
Leo, Angela
Gori, Valentina
Lulli, Matteo
Parri, Matteo
Becherucci, Valentina
Piccini, Luisa
Bambi, Franco
Taddei, Maria Letizia
Chiarugi, Paola
author_facet Pietrovito, Laura
Leo, Angela
Gori, Valentina
Lulli, Matteo
Parri, Matteo
Becherucci, Valentina
Piccini, Luisa
Bambi, Franco
Taddei, Maria Letizia
Chiarugi, Paola
author_sort Pietrovito, Laura
collection PubMed
description There is growing evidence to suggest that bone marrow‐derived mesenchymal stem cells (BM‐MSCs) are key players in tumour stroma. Here, we investigated the cross‐talk between BM‐MSCs and osteosarcoma (OS) cells. We revealed a strong tropism of BM‐MSCs towards these tumour cells and identified monocyte chemoattractant protein (MCP)‐1, growth‐regulated oncogene (GRO)‐α and transforming growth factor (TGF)‐β1 as pivotal factors for BM‐MSC chemotaxis. Once in contact with OS cells, BM‐MSCs trans‐differentiate into cancer‐associated fibroblasts, further increasing MCP‐1, GRO‐α, interleukin (IL)‐6 and IL‐8 levels in the tumour microenvironment. These cytokines promote mesenchymal to amoeboid transition (MAT), driven by activation of the small GTPase RhoA, in OS cells, as illustrated by the in vitro assay and live imaging. The outcome is a significant increase of aggressiveness in OS cells in terms of motility, invasiveness and transendothelial migration. In keeping with their enhanced transendothelial migration abilities, OS cells stimulated by BM‐MSCs also sustain migration, invasion and formation of the in vitro capillary network of endothelial cells. Thus, BM‐MSC recruitment to the OS site and the consequent cytokine‐induced MAT are crucial events in OS malignancy.
format Online
Article
Text
id pubmed-5928379
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-59283792018-05-07 Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition Pietrovito, Laura Leo, Angela Gori, Valentina Lulli, Matteo Parri, Matteo Becherucci, Valentina Piccini, Luisa Bambi, Franco Taddei, Maria Letizia Chiarugi, Paola Mol Oncol Research Articles There is growing evidence to suggest that bone marrow‐derived mesenchymal stem cells (BM‐MSCs) are key players in tumour stroma. Here, we investigated the cross‐talk between BM‐MSCs and osteosarcoma (OS) cells. We revealed a strong tropism of BM‐MSCs towards these tumour cells and identified monocyte chemoattractant protein (MCP)‐1, growth‐regulated oncogene (GRO)‐α and transforming growth factor (TGF)‐β1 as pivotal factors for BM‐MSC chemotaxis. Once in contact with OS cells, BM‐MSCs trans‐differentiate into cancer‐associated fibroblasts, further increasing MCP‐1, GRO‐α, interleukin (IL)‐6 and IL‐8 levels in the tumour microenvironment. These cytokines promote mesenchymal to amoeboid transition (MAT), driven by activation of the small GTPase RhoA, in OS cells, as illustrated by the in vitro assay and live imaging. The outcome is a significant increase of aggressiveness in OS cells in terms of motility, invasiveness and transendothelial migration. In keeping with their enhanced transendothelial migration abilities, OS cells stimulated by BM‐MSCs also sustain migration, invasion and formation of the in vitro capillary network of endothelial cells. Thus, BM‐MSC recruitment to the OS site and the consequent cytokine‐induced MAT are crucial events in OS malignancy. John Wiley and Sons Inc. 2018-03-31 2018-05 /pmc/articles/PMC5928379/ /pubmed/29517849 http://dx.doi.org/10.1002/1878-0261.12189 Text en © 2018 The Authors. Published by FEBS Press and John Wiley & Sons Ltd. This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Articles
Pietrovito, Laura
Leo, Angela
Gori, Valentina
Lulli, Matteo
Parri, Matteo
Becherucci, Valentina
Piccini, Luisa
Bambi, Franco
Taddei, Maria Letizia
Chiarugi, Paola
Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition
title Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition
title_full Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition
title_fullStr Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition
title_full_unstemmed Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition
title_short Bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition
title_sort bone marrow‐derived mesenchymal stem cells promote invasiveness and transendothelial migration of osteosarcoma cells via a mesenchymal to amoeboid transition
topic Research Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5928379/
https://www.ncbi.nlm.nih.gov/pubmed/29517849
http://dx.doi.org/10.1002/1878-0261.12189
work_keys_str_mv AT pietrovitolaura bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition
AT leoangela bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition
AT gorivalentina bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition
AT lullimatteo bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition
AT parrimatteo bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition
AT becheruccivalentina bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition
AT picciniluisa bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition
AT bambifranco bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition
AT taddeimarialetizia bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition
AT chiarugipaola bonemarrowderivedmesenchymalstemcellspromoteinvasivenessandtransendothelialmigrationofosteosarcomacellsviaamesenchymaltoamoeboidtransition