Cargando…

Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis

Breast cancer survivors are at an increased risk of second primary cancers, and the risk factors for the latter may have clinical significance. The aims of our study were to evaluate the incidences and risk factors of second primary female genital cancers (corpus uteri, cervix uteri plus ovary) in a...

Descripción completa

Detalles Bibliográficos
Autores principales: Li, Zhiyu, Wu, Qi, Song, Junlong, Zhang, Yimin, Zhu, Shan, Sun, Shengrong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Springer US 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5945714/
https://www.ncbi.nlm.nih.gov/pubmed/29556910
http://dx.doi.org/10.1007/s12672-018-0330-0
_version_ 1783322041887227904
author Li, Zhiyu
Wu, Qi
Song, Junlong
Zhang, Yimin
Zhu, Shan
Sun, Shengrong
author_facet Li, Zhiyu
Wu, Qi
Song, Junlong
Zhang, Yimin
Zhu, Shan
Sun, Shengrong
author_sort Li, Zhiyu
collection PubMed
description Breast cancer survivors are at an increased risk of second primary cancers, and the risk factors for the latter may have clinical significance. The aims of our study were to evaluate the incidences and risk factors of second primary female genital cancers (corpus uteri, cervix uteri plus ovary) in a large cohort of breast cancer survivors. Using the Surveillance, Epidemiology, and End Results (SEER) database, we examined the standardized incidence ratio (SIR) and risk factors for second primary female genital cancers observed between 2000 and 2014. Breast cancer survivors had increased SIRs for second corpus uteri cancers and second ovarian cancers and a decreased SIR for second cervical cancers (SIR 1.17, 1.12, and 0.64, respectively). Risk factors of second corpus uteri cancers were the age at first cancer diagnosis, race (black vs. white, aHR = 1.142 95% CI 1.005–1.298), and progesterone receptor (PR) status (PR+ vs. PR−, aHR = 1.131 95% CI 1.004–1.273). In addition, the risk of second ovarian cancer was positively associated with age while inversely associated with race (black vs. white, aHR = 0.691 95% CI 0.555–0.859) and estrogen receptor (ER) status (ER+ vs. ER−, aHR = 0.655 95% CI 0.544–0.788). Age, race, and hormone receptor status are risk factors of developing second female genital cancers among breast cancer survivors. Older age, black race, and a PR+ status in survivors are associated with a higher risk of second corpus uteri cancers. Additionally, older age and an ER− status should increase vigilance for potential second ovarian cancers. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1007/s12672-018-0330-0) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5945714
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Springer US
record_format MEDLINE/PubMed
spelling pubmed-59457142018-05-15 Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis Li, Zhiyu Wu, Qi Song, Junlong Zhang, Yimin Zhu, Shan Sun, Shengrong Horm Cancer Original Paper Breast cancer survivors are at an increased risk of second primary cancers, and the risk factors for the latter may have clinical significance. The aims of our study were to evaluate the incidences and risk factors of second primary female genital cancers (corpus uteri, cervix uteri plus ovary) in a large cohort of breast cancer survivors. Using the Surveillance, Epidemiology, and End Results (SEER) database, we examined the standardized incidence ratio (SIR) and risk factors for second primary female genital cancers observed between 2000 and 2014. Breast cancer survivors had increased SIRs for second corpus uteri cancers and second ovarian cancers and a decreased SIR for second cervical cancers (SIR 1.17, 1.12, and 0.64, respectively). Risk factors of second corpus uteri cancers were the age at first cancer diagnosis, race (black vs. white, aHR = 1.142 95% CI 1.005–1.298), and progesterone receptor (PR) status (PR+ vs. PR−, aHR = 1.131 95% CI 1.004–1.273). In addition, the risk of second ovarian cancer was positively associated with age while inversely associated with race (black vs. white, aHR = 0.691 95% CI 0.555–0.859) and estrogen receptor (ER) status (ER+ vs. ER−, aHR = 0.655 95% CI 0.544–0.788). Age, race, and hormone receptor status are risk factors of developing second female genital cancers among breast cancer survivors. Older age, black race, and a PR+ status in survivors are associated with a higher risk of second corpus uteri cancers. Additionally, older age and an ER− status should increase vigilance for potential second ovarian cancers. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1007/s12672-018-0330-0) contains supplementary material, which is available to authorized users. Springer US 2018-03-19 /pmc/articles/PMC5945714/ /pubmed/29556910 http://dx.doi.org/10.1007/s12672-018-0330-0 Text en © The Author(s) 2018 https://creativecommons.org/licenses/by/4.0/Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.
spellingShingle Original Paper
Li, Zhiyu
Wu, Qi
Song, Junlong
Zhang, Yimin
Zhu, Shan
Sun, Shengrong
Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis
title Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis
title_full Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis
title_fullStr Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis
title_full_unstemmed Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis
title_short Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis
title_sort risk of second primary female genital malignancies in women with breast cancer: a seer analysis
topic Original Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5945714/
https://www.ncbi.nlm.nih.gov/pubmed/29556910
http://dx.doi.org/10.1007/s12672-018-0330-0
work_keys_str_mv AT lizhiyu riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis
AT wuqi riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis
AT songjunlong riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis
AT zhangyimin riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis
AT zhushan riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis
AT sunshengrong riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis