Cargando…
Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis
Breast cancer survivors are at an increased risk of second primary cancers, and the risk factors for the latter may have clinical significance. The aims of our study were to evaluate the incidences and risk factors of second primary female genital cancers (corpus uteri, cervix uteri plus ovary) in a...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer US
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5945714/ https://www.ncbi.nlm.nih.gov/pubmed/29556910 http://dx.doi.org/10.1007/s12672-018-0330-0 |
_version_ | 1783322041887227904 |
---|---|
author | Li, Zhiyu Wu, Qi Song, Junlong Zhang, Yimin Zhu, Shan Sun, Shengrong |
author_facet | Li, Zhiyu Wu, Qi Song, Junlong Zhang, Yimin Zhu, Shan Sun, Shengrong |
author_sort | Li, Zhiyu |
collection | PubMed |
description | Breast cancer survivors are at an increased risk of second primary cancers, and the risk factors for the latter may have clinical significance. The aims of our study were to evaluate the incidences and risk factors of second primary female genital cancers (corpus uteri, cervix uteri plus ovary) in a large cohort of breast cancer survivors. Using the Surveillance, Epidemiology, and End Results (SEER) database, we examined the standardized incidence ratio (SIR) and risk factors for second primary female genital cancers observed between 2000 and 2014. Breast cancer survivors had increased SIRs for second corpus uteri cancers and second ovarian cancers and a decreased SIR for second cervical cancers (SIR 1.17, 1.12, and 0.64, respectively). Risk factors of second corpus uteri cancers were the age at first cancer diagnosis, race (black vs. white, aHR = 1.142 95% CI 1.005–1.298), and progesterone receptor (PR) status (PR+ vs. PR−, aHR = 1.131 95% CI 1.004–1.273). In addition, the risk of second ovarian cancer was positively associated with age while inversely associated with race (black vs. white, aHR = 0.691 95% CI 0.555–0.859) and estrogen receptor (ER) status (ER+ vs. ER−, aHR = 0.655 95% CI 0.544–0.788). Age, race, and hormone receptor status are risk factors of developing second female genital cancers among breast cancer survivors. Older age, black race, and a PR+ status in survivors are associated with a higher risk of second corpus uteri cancers. Additionally, older age and an ER− status should increase vigilance for potential second ovarian cancers. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1007/s12672-018-0330-0) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5945714 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Springer US |
record_format | MEDLINE/PubMed |
spelling | pubmed-59457142018-05-15 Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis Li, Zhiyu Wu, Qi Song, Junlong Zhang, Yimin Zhu, Shan Sun, Shengrong Horm Cancer Original Paper Breast cancer survivors are at an increased risk of second primary cancers, and the risk factors for the latter may have clinical significance. The aims of our study were to evaluate the incidences and risk factors of second primary female genital cancers (corpus uteri, cervix uteri plus ovary) in a large cohort of breast cancer survivors. Using the Surveillance, Epidemiology, and End Results (SEER) database, we examined the standardized incidence ratio (SIR) and risk factors for second primary female genital cancers observed between 2000 and 2014. Breast cancer survivors had increased SIRs for second corpus uteri cancers and second ovarian cancers and a decreased SIR for second cervical cancers (SIR 1.17, 1.12, and 0.64, respectively). Risk factors of second corpus uteri cancers were the age at first cancer diagnosis, race (black vs. white, aHR = 1.142 95% CI 1.005–1.298), and progesterone receptor (PR) status (PR+ vs. PR−, aHR = 1.131 95% CI 1.004–1.273). In addition, the risk of second ovarian cancer was positively associated with age while inversely associated with race (black vs. white, aHR = 0.691 95% CI 0.555–0.859) and estrogen receptor (ER) status (ER+ vs. ER−, aHR = 0.655 95% CI 0.544–0.788). Age, race, and hormone receptor status are risk factors of developing second female genital cancers among breast cancer survivors. Older age, black race, and a PR+ status in survivors are associated with a higher risk of second corpus uteri cancers. Additionally, older age and an ER− status should increase vigilance for potential second ovarian cancers. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1007/s12672-018-0330-0) contains supplementary material, which is available to authorized users. Springer US 2018-03-19 /pmc/articles/PMC5945714/ /pubmed/29556910 http://dx.doi.org/10.1007/s12672-018-0330-0 Text en © The Author(s) 2018 https://creativecommons.org/licenses/by/4.0/Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. |
spellingShingle | Original Paper Li, Zhiyu Wu, Qi Song, Junlong Zhang, Yimin Zhu, Shan Sun, Shengrong Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis |
title | Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis |
title_full | Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis |
title_fullStr | Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis |
title_full_unstemmed | Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis |
title_short | Risk of Second Primary Female Genital Malignancies in Women with Breast Cancer: a SEER Analysis |
title_sort | risk of second primary female genital malignancies in women with breast cancer: a seer analysis |
topic | Original Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5945714/ https://www.ncbi.nlm.nih.gov/pubmed/29556910 http://dx.doi.org/10.1007/s12672-018-0330-0 |
work_keys_str_mv | AT lizhiyu riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis AT wuqi riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis AT songjunlong riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis AT zhangyimin riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis AT zhushan riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis AT sunshengrong riskofsecondprimaryfemalegenitalmalignanciesinwomenwithbreastcanceraseeranalysis |