Cargando…

Assessing safety climate in acute hospital settings: a systematic review of the adequacy of the psychometric properties of survey measurement tools

BACKGROUND: The perceived importance of safety culture in improving patient safety and its impact on patient outcomes has led to a growing interest in the assessment of safety climate in healthcare organizations; however, the rigour with which safety climate tools were developed and psychometrically...

Descripción completa

Detalles Bibliográficos
Autores principales: Alsalem, Gheed, Bowie, Paul, Morrison, Jillian
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5946435/
https://www.ncbi.nlm.nih.gov/pubmed/29747612
http://dx.doi.org/10.1186/s12913-018-3167-x
_version_ 1783322196907655168
author Alsalem, Gheed
Bowie, Paul
Morrison, Jillian
author_facet Alsalem, Gheed
Bowie, Paul
Morrison, Jillian
author_sort Alsalem, Gheed
collection PubMed
description BACKGROUND: The perceived importance of safety culture in improving patient safety and its impact on patient outcomes has led to a growing interest in the assessment of safety climate in healthcare organizations; however, the rigour with which safety climate tools were developed and psychometrically tested was shown to be variable. This paper aims to identify and review questionnaire studies designed to measure safety climate in acute hospital settings, in order to assess the adequacy of reported psychometric properties of identified tools. METHODS: A systematic review of published empirical literature was undertaken to examine sample characteristics and instrument details including safety climate dimensions, origin and theoretical basis, and extent of psychometric evaluation (content validity, criterion validity, construct validity and internal reliability). RESULTS: Five questionnaire tools, designed for general evaluation of safety climate in acute hospital settings, were included. Detailed inspection revealed ambiguity around concepts of safety culture and climate, safety climate dimensions and the methodological rigour associated with the design of these measures. Standard reporting of the psychometric properties of developed questionnaires was variable, although evidence of an improving trend in the quality of the reported psychometric properties of studies was noted. Evidence of the theoretical underpinnings of climate tools was limited, while a lack of clarity in the relationship between safety culture and patient outcome measures still exists. CONCLUSIONS: Evidence of the adequacy of the psychometric development of safety climate questionnaire tools is still limited. Research is necessary to resolve the controversies in the definitions and dimensions of safety culture and climate in healthcare and identify related inconsistencies. More importance should be given to the appropriate validation of safety climate questionnaires before extending their usage in healthcare contexts different from those in which they were originally developed. Mixed methods research to understand why psychometric assessment and measurement reporting practices can be inadequate and lacking in a theoretical basis is also necessary. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12913-018-3167-x) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5946435
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-59464352018-05-14 Assessing safety climate in acute hospital settings: a systematic review of the adequacy of the psychometric properties of survey measurement tools Alsalem, Gheed Bowie, Paul Morrison, Jillian BMC Health Serv Res Research Article BACKGROUND: The perceived importance of safety culture in improving patient safety and its impact on patient outcomes has led to a growing interest in the assessment of safety climate in healthcare organizations; however, the rigour with which safety climate tools were developed and psychometrically tested was shown to be variable. This paper aims to identify and review questionnaire studies designed to measure safety climate in acute hospital settings, in order to assess the adequacy of reported psychometric properties of identified tools. METHODS: A systematic review of published empirical literature was undertaken to examine sample characteristics and instrument details including safety climate dimensions, origin and theoretical basis, and extent of psychometric evaluation (content validity, criterion validity, construct validity and internal reliability). RESULTS: Five questionnaire tools, designed for general evaluation of safety climate in acute hospital settings, were included. Detailed inspection revealed ambiguity around concepts of safety culture and climate, safety climate dimensions and the methodological rigour associated with the design of these measures. Standard reporting of the psychometric properties of developed questionnaires was variable, although evidence of an improving trend in the quality of the reported psychometric properties of studies was noted. Evidence of the theoretical underpinnings of climate tools was limited, while a lack of clarity in the relationship between safety culture and patient outcome measures still exists. CONCLUSIONS: Evidence of the adequacy of the psychometric development of safety climate questionnaire tools is still limited. Research is necessary to resolve the controversies in the definitions and dimensions of safety culture and climate in healthcare and identify related inconsistencies. More importance should be given to the appropriate validation of safety climate questionnaires before extending their usage in healthcare contexts different from those in which they were originally developed. Mixed methods research to understand why psychometric assessment and measurement reporting practices can be inadequate and lacking in a theoretical basis is also necessary. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12913-018-3167-x) contains supplementary material, which is available to authorized users. BioMed Central 2018-05-10 /pmc/articles/PMC5946435/ /pubmed/29747612 http://dx.doi.org/10.1186/s12913-018-3167-x Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Alsalem, Gheed
Bowie, Paul
Morrison, Jillian
Assessing safety climate in acute hospital settings: a systematic review of the adequacy of the psychometric properties of survey measurement tools
title Assessing safety climate in acute hospital settings: a systematic review of the adequacy of the psychometric properties of survey measurement tools
title_full Assessing safety climate in acute hospital settings: a systematic review of the adequacy of the psychometric properties of survey measurement tools
title_fullStr Assessing safety climate in acute hospital settings: a systematic review of the adequacy of the psychometric properties of survey measurement tools
title_full_unstemmed Assessing safety climate in acute hospital settings: a systematic review of the adequacy of the psychometric properties of survey measurement tools
title_short Assessing safety climate in acute hospital settings: a systematic review of the adequacy of the psychometric properties of survey measurement tools
title_sort assessing safety climate in acute hospital settings: a systematic review of the adequacy of the psychometric properties of survey measurement tools
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5946435/
https://www.ncbi.nlm.nih.gov/pubmed/29747612
http://dx.doi.org/10.1186/s12913-018-3167-x
work_keys_str_mv AT alsalemgheed assessingsafetyclimateinacutehospitalsettingsasystematicreviewoftheadequacyofthepsychometricpropertiesofsurveymeasurementtools
AT bowiepaul assessingsafetyclimateinacutehospitalsettingsasystematicreviewoftheadequacyofthepsychometricpropertiesofsurveymeasurementtools
AT morrisonjillian assessingsafetyclimateinacutehospitalsettingsasystematicreviewoftheadequacyofthepsychometricpropertiesofsurveymeasurementtools