Cargando…

Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?

Patients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymp...

Descripción completa

Detalles Bibliográficos
Autores principales: Ghosh, Sujal, Drexler, Ingo, Bhatia, Sanil, Adler, Heiko, Gennery, Andrew R., Borkhardt, Arndt
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5951928/
https://www.ncbi.nlm.nih.gov/pubmed/29867957
http://dx.doi.org/10.3389/fimmu.2018.00979
_version_ 1783323099169554432
author Ghosh, Sujal
Drexler, Ingo
Bhatia, Sanil
Adler, Heiko
Gennery, Andrew R.
Borkhardt, Arndt
author_facet Ghosh, Sujal
Drexler, Ingo
Bhatia, Sanil
Adler, Heiko
Gennery, Andrew R.
Borkhardt, Arndt
author_sort Ghosh, Sujal
collection PubMed
description Patients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymphohistiocytosis, and dysgammaglobulinemia. In this review, we give an update on further reported patients. We believe that current clinical data advocate early definitive treatment by hematopoietic stem cell transplantation, as transplant outcome in primary immunodeficiency disorders in general has gradually improved in recent years. Furthermore, we summarize experimental data in the murine model to provide further insight of pathophysiology in ITK deficiency.
format Online
Article
Text
id pubmed-5951928
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-59519282018-06-04 Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? Ghosh, Sujal Drexler, Ingo Bhatia, Sanil Adler, Heiko Gennery, Andrew R. Borkhardt, Arndt Front Immunol Immunology Patients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymphohistiocytosis, and dysgammaglobulinemia. In this review, we give an update on further reported patients. We believe that current clinical data advocate early definitive treatment by hematopoietic stem cell transplantation, as transplant outcome in primary immunodeficiency disorders in general has gradually improved in recent years. Furthermore, we summarize experimental data in the murine model to provide further insight of pathophysiology in ITK deficiency. Frontiers Media S.A. 2018-05-08 /pmc/articles/PMC5951928/ /pubmed/29867957 http://dx.doi.org/10.3389/fimmu.2018.00979 Text en Copyright © 2018 Ghosh, Drexler, Bhatia, Adler, Gennery and Borkhardt. https://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Immunology
Ghosh, Sujal
Drexler, Ingo
Bhatia, Sanil
Adler, Heiko
Gennery, Andrew R.
Borkhardt, Arndt
Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
title Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
title_full Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
title_fullStr Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
title_full_unstemmed Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
title_short Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
title_sort interleukin-2-inducible t-cell kinase deficiency—new patients, new insight?
topic Immunology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5951928/
https://www.ncbi.nlm.nih.gov/pubmed/29867957
http://dx.doi.org/10.3389/fimmu.2018.00979
work_keys_str_mv AT ghoshsujal interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT drexleringo interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT bhatiasanil interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT adlerheiko interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT genneryandrewr interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight
AT borkhardtarndt interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight