Cargando…
Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight?
Patients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymp...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5951928/ https://www.ncbi.nlm.nih.gov/pubmed/29867957 http://dx.doi.org/10.3389/fimmu.2018.00979 |
_version_ | 1783323099169554432 |
---|---|
author | Ghosh, Sujal Drexler, Ingo Bhatia, Sanil Adler, Heiko Gennery, Andrew R. Borkhardt, Arndt |
author_facet | Ghosh, Sujal Drexler, Ingo Bhatia, Sanil Adler, Heiko Gennery, Andrew R. Borkhardt, Arndt |
author_sort | Ghosh, Sujal |
collection | PubMed |
description | Patients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymphohistiocytosis, and dysgammaglobulinemia. In this review, we give an update on further reported patients. We believe that current clinical data advocate early definitive treatment by hematopoietic stem cell transplantation, as transplant outcome in primary immunodeficiency disorders in general has gradually improved in recent years. Furthermore, we summarize experimental data in the murine model to provide further insight of pathophysiology in ITK deficiency. |
format | Online Article Text |
id | pubmed-5951928 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-59519282018-06-04 Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? Ghosh, Sujal Drexler, Ingo Bhatia, Sanil Adler, Heiko Gennery, Andrew R. Borkhardt, Arndt Front Immunol Immunology Patients with primary immunodeficiency can be prone to severe Epstein–Barr virus (EBV) associated immune dysregulation. Individuals with mutations in the interleukin-2-inducible T-cell kinase (ITK) gene experience Hodgkin and non-Hodgkin lymphoma, EBV lymphoproliferative disease, hemophagocytic lymphohistiocytosis, and dysgammaglobulinemia. In this review, we give an update on further reported patients. We believe that current clinical data advocate early definitive treatment by hematopoietic stem cell transplantation, as transplant outcome in primary immunodeficiency disorders in general has gradually improved in recent years. Furthermore, we summarize experimental data in the murine model to provide further insight of pathophysiology in ITK deficiency. Frontiers Media S.A. 2018-05-08 /pmc/articles/PMC5951928/ /pubmed/29867957 http://dx.doi.org/10.3389/fimmu.2018.00979 Text en Copyright © 2018 Ghosh, Drexler, Bhatia, Adler, Gennery and Borkhardt. https://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Immunology Ghosh, Sujal Drexler, Ingo Bhatia, Sanil Adler, Heiko Gennery, Andrew R. Borkhardt, Arndt Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title | Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_full | Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_fullStr | Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_full_unstemmed | Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_short | Interleukin-2-Inducible T-Cell Kinase Deficiency—New Patients, New Insight? |
title_sort | interleukin-2-inducible t-cell kinase deficiency—new patients, new insight? |
topic | Immunology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5951928/ https://www.ncbi.nlm.nih.gov/pubmed/29867957 http://dx.doi.org/10.3389/fimmu.2018.00979 |
work_keys_str_mv | AT ghoshsujal interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT drexleringo interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT bhatiasanil interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT adlerheiko interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT genneryandrewr interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight AT borkhardtarndt interleukin2inducibletcellkinasedeficiencynewpatientsnewinsight |