Cargando…

Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992

Systematic reviews of existing research are needed to help reduce the enormous amount of wasted resources in biomedical research. Whether already available or needed but unavailable, systematic reviews are a key element in prioritising questions for new research, and for informing the design of addi...

Descripción completa

Detalles Bibliográficos
Autor principal: Chalmers, Iain
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5952701/
https://www.ncbi.nlm.nih.gov/pubmed/29764443
http://dx.doi.org/10.1186/s12978-018-0518-3
_version_ 1783323241438248960
author Chalmers, Iain
author_facet Chalmers, Iain
author_sort Chalmers, Iain
collection PubMed
description Systematic reviews of existing research are needed to help reduce the enormous amount of wasted resources in biomedical research. Whether already available or needed but unavailable, systematic reviews are a key element in prioritising questions for new research, and for informing the design of additional studies. One of the most important of Adrian Grant’s many contributions was to recognise this a decade before it began to become more widely accepted. In this sphere, as well as in many others, he was a real pioneer.
format Online
Article
Text
id pubmed-5952701
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-59527012018-05-21 Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992 Chalmers, Iain Reprod Health Commentary Systematic reviews of existing research are needed to help reduce the enormous amount of wasted resources in biomedical research. Whether already available or needed but unavailable, systematic reviews are a key element in prioritising questions for new research, and for informing the design of additional studies. One of the most important of Adrian Grant’s many contributions was to recognise this a decade before it began to become more widely accepted. In this sphere, as well as in many others, he was a real pioneer. BioMed Central 2018-05-15 /pmc/articles/PMC5952701/ /pubmed/29764443 http://dx.doi.org/10.1186/s12978-018-0518-3 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Commentary
Chalmers, Iain
Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992
title Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992
title_full Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992
title_fullStr Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992
title_full_unstemmed Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992
title_short Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992
title_sort adrian grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992
topic Commentary
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5952701/
https://www.ncbi.nlm.nih.gov/pubmed/29764443
http://dx.doi.org/10.1186/s12978-018-0518-3
work_keys_str_mv AT chalmersiain adriangrantspioneeringuseofevidencesynthesisinperinatalmedicine19801992