Cargando…
Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992
Systematic reviews of existing research are needed to help reduce the enormous amount of wasted resources in biomedical research. Whether already available or needed but unavailable, systematic reviews are a key element in prioritising questions for new research, and for informing the design of addi...
Autor principal: | |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5952701/ https://www.ncbi.nlm.nih.gov/pubmed/29764443 http://dx.doi.org/10.1186/s12978-018-0518-3 |
_version_ | 1783323241438248960 |
---|---|
author | Chalmers, Iain |
author_facet | Chalmers, Iain |
author_sort | Chalmers, Iain |
collection | PubMed |
description | Systematic reviews of existing research are needed to help reduce the enormous amount of wasted resources in biomedical research. Whether already available or needed but unavailable, systematic reviews are a key element in prioritising questions for new research, and for informing the design of additional studies. One of the most important of Adrian Grant’s many contributions was to recognise this a decade before it began to become more widely accepted. In this sphere, as well as in many others, he was a real pioneer. |
format | Online Article Text |
id | pubmed-5952701 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-59527012018-05-21 Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992 Chalmers, Iain Reprod Health Commentary Systematic reviews of existing research are needed to help reduce the enormous amount of wasted resources in biomedical research. Whether already available or needed but unavailable, systematic reviews are a key element in prioritising questions for new research, and for informing the design of additional studies. One of the most important of Adrian Grant’s many contributions was to recognise this a decade before it began to become more widely accepted. In this sphere, as well as in many others, he was a real pioneer. BioMed Central 2018-05-15 /pmc/articles/PMC5952701/ /pubmed/29764443 http://dx.doi.org/10.1186/s12978-018-0518-3 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Commentary Chalmers, Iain Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992 |
title | Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992 |
title_full | Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992 |
title_fullStr | Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992 |
title_full_unstemmed | Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992 |
title_short | Adrian Grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992 |
title_sort | adrian grant’s pioneering use of evidence synthesis in perinatal medicine, 1980–1992 |
topic | Commentary |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5952701/ https://www.ncbi.nlm.nih.gov/pubmed/29764443 http://dx.doi.org/10.1186/s12978-018-0518-3 |
work_keys_str_mv | AT chalmersiain adriangrantspioneeringuseofevidencesynthesisinperinatalmedicine19801992 |