Cargando…

Sex differences in cardiovascular epigenetics—a systematic review

BACKGROUND: Differences in cardiovascular diseases are evident in men and women throughout life and are mainly attributed to the presence of sex hormones and chromosomes. Epigenetic mechanisms drive the regulation of the biological processes that may lead to CVD and are possibly influenced by sex. I...

Descripción completa

Detalles Bibliográficos
Autores principales: Hartman, Robin J. G., Huisman, Sarah E., den Ruijter, Hester M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5966883/
https://www.ncbi.nlm.nih.gov/pubmed/29792221
http://dx.doi.org/10.1186/s13293-018-0180-z
_version_ 1783325527668424704
author Hartman, Robin J. G.
Huisman, Sarah E.
den Ruijter, Hester M.
author_facet Hartman, Robin J. G.
Huisman, Sarah E.
den Ruijter, Hester M.
author_sort Hartman, Robin J. G.
collection PubMed
description BACKGROUND: Differences in cardiovascular diseases are evident in men and women throughout life and are mainly attributed to the presence of sex hormones and chromosomes. Epigenetic mechanisms drive the regulation of the biological processes that may lead to CVD and are possibly influenced by sex. In order to gain an overview of the status quo on sex differences in cardiovascular epigenetics, we performed a systematic review. MATERIALS AND METHODS: A systematic search was performed on PubMed and Embase for studies mentioning cardiovascular disease, epigenetics, and anything related to sex differences. The search returned 3071 publications to be screened. Primary included publications focused on cardiovascular and epigenetics research. Subsequently, papers were assessed for including both sexes in their studies and checked for appropriate sex stratification of results. RESULTS: Two independent screeners identified 75 papers in the proper domains that had included both sexes. Only 17% (13 papers out of 75) of these publications stratified some of their data according to sex. All remaining papers focused on DNA methylation solely as an epigenetic mechanism. Of the excluded papers that included only one sex, 86% (24 out 28) studied males, while 14% (4 out of 28) studied females. CONCLUSION: Our overview indicates that the majority of studies into cardiovascular epigenetics do not show their data stratified by sex, despite the well-known sex differences in CVD. All included and sex-stratified papers focus on DNA methylation, indicating that a lot of ground is still to gain regarding other epigenetic mechanisms, like chromatin architecture, and histone modifications. More attention to sex in epigenetic studies is warranted as such integration will advance our understanding of cardiovascular disease mechanisms in men and women. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13293-018-0180-z) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5966883
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-59668832018-05-24 Sex differences in cardiovascular epigenetics—a systematic review Hartman, Robin J. G. Huisman, Sarah E. den Ruijter, Hester M. Biol Sex Differ Review BACKGROUND: Differences in cardiovascular diseases are evident in men and women throughout life and are mainly attributed to the presence of sex hormones and chromosomes. Epigenetic mechanisms drive the regulation of the biological processes that may lead to CVD and are possibly influenced by sex. In order to gain an overview of the status quo on sex differences in cardiovascular epigenetics, we performed a systematic review. MATERIALS AND METHODS: A systematic search was performed on PubMed and Embase for studies mentioning cardiovascular disease, epigenetics, and anything related to sex differences. The search returned 3071 publications to be screened. Primary included publications focused on cardiovascular and epigenetics research. Subsequently, papers were assessed for including both sexes in their studies and checked for appropriate sex stratification of results. RESULTS: Two independent screeners identified 75 papers in the proper domains that had included both sexes. Only 17% (13 papers out of 75) of these publications stratified some of their data according to sex. All remaining papers focused on DNA methylation solely as an epigenetic mechanism. Of the excluded papers that included only one sex, 86% (24 out 28) studied males, while 14% (4 out of 28) studied females. CONCLUSION: Our overview indicates that the majority of studies into cardiovascular epigenetics do not show their data stratified by sex, despite the well-known sex differences in CVD. All included and sex-stratified papers focus on DNA methylation, indicating that a lot of ground is still to gain regarding other epigenetic mechanisms, like chromatin architecture, and histone modifications. More attention to sex in epigenetic studies is warranted as such integration will advance our understanding of cardiovascular disease mechanisms in men and women. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13293-018-0180-z) contains supplementary material, which is available to authorized users. BioMed Central 2018-05-23 /pmc/articles/PMC5966883/ /pubmed/29792221 http://dx.doi.org/10.1186/s13293-018-0180-z Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Review
Hartman, Robin J. G.
Huisman, Sarah E.
den Ruijter, Hester M.
Sex differences in cardiovascular epigenetics—a systematic review
title Sex differences in cardiovascular epigenetics—a systematic review
title_full Sex differences in cardiovascular epigenetics—a systematic review
title_fullStr Sex differences in cardiovascular epigenetics—a systematic review
title_full_unstemmed Sex differences in cardiovascular epigenetics—a systematic review
title_short Sex differences in cardiovascular epigenetics—a systematic review
title_sort sex differences in cardiovascular epigenetics—a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5966883/
https://www.ncbi.nlm.nih.gov/pubmed/29792221
http://dx.doi.org/10.1186/s13293-018-0180-z
work_keys_str_mv AT hartmanrobinjg sexdifferencesincardiovascularepigeneticsasystematicreview
AT huismansarahe sexdifferencesincardiovascularepigeneticsasystematicreview
AT denruijterhesterm sexdifferencesincardiovascularepigeneticsasystematicreview