Cargando…
Sex differences in cardiovascular epigenetics—a systematic review
BACKGROUND: Differences in cardiovascular diseases are evident in men and women throughout life and are mainly attributed to the presence of sex hormones and chromosomes. Epigenetic mechanisms drive the regulation of the biological processes that may lead to CVD and are possibly influenced by sex. I...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5966883/ https://www.ncbi.nlm.nih.gov/pubmed/29792221 http://dx.doi.org/10.1186/s13293-018-0180-z |
_version_ | 1783325527668424704 |
---|---|
author | Hartman, Robin J. G. Huisman, Sarah E. den Ruijter, Hester M. |
author_facet | Hartman, Robin J. G. Huisman, Sarah E. den Ruijter, Hester M. |
author_sort | Hartman, Robin J. G. |
collection | PubMed |
description | BACKGROUND: Differences in cardiovascular diseases are evident in men and women throughout life and are mainly attributed to the presence of sex hormones and chromosomes. Epigenetic mechanisms drive the regulation of the biological processes that may lead to CVD and are possibly influenced by sex. In order to gain an overview of the status quo on sex differences in cardiovascular epigenetics, we performed a systematic review. MATERIALS AND METHODS: A systematic search was performed on PubMed and Embase for studies mentioning cardiovascular disease, epigenetics, and anything related to sex differences. The search returned 3071 publications to be screened. Primary included publications focused on cardiovascular and epigenetics research. Subsequently, papers were assessed for including both sexes in their studies and checked for appropriate sex stratification of results. RESULTS: Two independent screeners identified 75 papers in the proper domains that had included both sexes. Only 17% (13 papers out of 75) of these publications stratified some of their data according to sex. All remaining papers focused on DNA methylation solely as an epigenetic mechanism. Of the excluded papers that included only one sex, 86% (24 out 28) studied males, while 14% (4 out of 28) studied females. CONCLUSION: Our overview indicates that the majority of studies into cardiovascular epigenetics do not show their data stratified by sex, despite the well-known sex differences in CVD. All included and sex-stratified papers focus on DNA methylation, indicating that a lot of ground is still to gain regarding other epigenetic mechanisms, like chromatin architecture, and histone modifications. More attention to sex in epigenetic studies is warranted as such integration will advance our understanding of cardiovascular disease mechanisms in men and women. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13293-018-0180-z) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5966883 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-59668832018-05-24 Sex differences in cardiovascular epigenetics—a systematic review Hartman, Robin J. G. Huisman, Sarah E. den Ruijter, Hester M. Biol Sex Differ Review BACKGROUND: Differences in cardiovascular diseases are evident in men and women throughout life and are mainly attributed to the presence of sex hormones and chromosomes. Epigenetic mechanisms drive the regulation of the biological processes that may lead to CVD and are possibly influenced by sex. In order to gain an overview of the status quo on sex differences in cardiovascular epigenetics, we performed a systematic review. MATERIALS AND METHODS: A systematic search was performed on PubMed and Embase for studies mentioning cardiovascular disease, epigenetics, and anything related to sex differences. The search returned 3071 publications to be screened. Primary included publications focused on cardiovascular and epigenetics research. Subsequently, papers were assessed for including both sexes in their studies and checked for appropriate sex stratification of results. RESULTS: Two independent screeners identified 75 papers in the proper domains that had included both sexes. Only 17% (13 papers out of 75) of these publications stratified some of their data according to sex. All remaining papers focused on DNA methylation solely as an epigenetic mechanism. Of the excluded papers that included only one sex, 86% (24 out 28) studied males, while 14% (4 out of 28) studied females. CONCLUSION: Our overview indicates that the majority of studies into cardiovascular epigenetics do not show their data stratified by sex, despite the well-known sex differences in CVD. All included and sex-stratified papers focus on DNA methylation, indicating that a lot of ground is still to gain regarding other epigenetic mechanisms, like chromatin architecture, and histone modifications. More attention to sex in epigenetic studies is warranted as such integration will advance our understanding of cardiovascular disease mechanisms in men and women. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13293-018-0180-z) contains supplementary material, which is available to authorized users. BioMed Central 2018-05-23 /pmc/articles/PMC5966883/ /pubmed/29792221 http://dx.doi.org/10.1186/s13293-018-0180-z Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Review Hartman, Robin J. G. Huisman, Sarah E. den Ruijter, Hester M. Sex differences in cardiovascular epigenetics—a systematic review |
title | Sex differences in cardiovascular epigenetics—a systematic review |
title_full | Sex differences in cardiovascular epigenetics—a systematic review |
title_fullStr | Sex differences in cardiovascular epigenetics—a systematic review |
title_full_unstemmed | Sex differences in cardiovascular epigenetics—a systematic review |
title_short | Sex differences in cardiovascular epigenetics—a systematic review |
title_sort | sex differences in cardiovascular epigenetics—a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5966883/ https://www.ncbi.nlm.nih.gov/pubmed/29792221 http://dx.doi.org/10.1186/s13293-018-0180-z |
work_keys_str_mv | AT hartmanrobinjg sexdifferencesincardiovascularepigeneticsasystematicreview AT huismansarahe sexdifferencesincardiovascularepigeneticsasystematicreview AT denruijterhesterm sexdifferencesincardiovascularepigeneticsasystematicreview |