Cargando…
Mapping and modelling the impact of mass drug adminstration on filariasis prevalence in Myanmar
BACKGROUND: Lymphatic filariasis (LF) is endemic in Myanmar and targeted for elimination. To highlight the National Programme to Eliminate Lymphatic Filariasis (NPELF) progress between 2000 and 2014, this paper describes the geographical distribution of LF, the scale-up and impact of mass drug admin...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5984392/ https://www.ncbi.nlm.nih.gov/pubmed/29855355 http://dx.doi.org/10.1186/s40249-018-0420-9 |
_version_ | 1783328606412341248 |
---|---|
author | Aye, Ni Ni Lin, Zaw Lon, Khin Nan Linn, Nay Yi Yi Nwe, Thet Wai Mon, Khin Mon Ramaiah, Kapa Betts, Hannah Kelly-Hope, Louise A. |
author_facet | Aye, Ni Ni Lin, Zaw Lon, Khin Nan Linn, Nay Yi Yi Nwe, Thet Wai Mon, Khin Mon Ramaiah, Kapa Betts, Hannah Kelly-Hope, Louise A. |
author_sort | Aye, Ni Ni |
collection | PubMed |
description | BACKGROUND: Lymphatic filariasis (LF) is endemic in Myanmar and targeted for elimination. To highlight the National Programme to Eliminate Lymphatic Filariasis (NPELF) progress between 2000 and 2014, this paper describes the geographical distribution of LF, the scale-up and impact of mass drug administration (MDA) implementation, and the first evidence of the decline in transmission in five districts. METHODS: The LF distribution was determined by mapping historical and baseline prevalence data collected by NPELF. Data on the MDA implementation, reported coverage rates and sentinel site surveillance were summarized. A statistical model was developed from the available prevalence data to predict prevalence at township level by year of measurement. Transmission assessment survey (TAS) methods, measuring antigenemia (Ag) prevalence in children, were used to determine whether prevalence was below a level where recrudescence is unlikely to occur. RESULTS: The highest baseline LF prevalence was found in the Central Valley region. The MDA implementation activities scaled up to cover 45 districts, representing the majority of the endemic population, with drug coverage rates ranging from 60.0% to 98.5%. Challenges related to drug supply and local conflict were reported, and interrupted MDA in some districts. Overall, significant reductions in LF prevalence were found, especially after the first 2 to 3 rounds of MDA, which was supported by the corresponding model. The TAS activities in five districts found only two Ag positive children, resulting in all districts passing the critical threshold. CONCLUSION: Overall, the Myanmar NPELF has made positive steps forward in the elimination of LF despite several challenges, however, it needs to maintain momentum, drawing on international stakeholder support, to aim towards the national and global goals of elimination. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s40249-018-0420-9) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5984392 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-59843922018-06-07 Mapping and modelling the impact of mass drug adminstration on filariasis prevalence in Myanmar Aye, Ni Ni Lin, Zaw Lon, Khin Nan Linn, Nay Yi Yi Nwe, Thet Wai Mon, Khin Mon Ramaiah, Kapa Betts, Hannah Kelly-Hope, Louise A. Infect Dis Poverty Research Article BACKGROUND: Lymphatic filariasis (LF) is endemic in Myanmar and targeted for elimination. To highlight the National Programme to Eliminate Lymphatic Filariasis (NPELF) progress between 2000 and 2014, this paper describes the geographical distribution of LF, the scale-up and impact of mass drug administration (MDA) implementation, and the first evidence of the decline in transmission in five districts. METHODS: The LF distribution was determined by mapping historical and baseline prevalence data collected by NPELF. Data on the MDA implementation, reported coverage rates and sentinel site surveillance were summarized. A statistical model was developed from the available prevalence data to predict prevalence at township level by year of measurement. Transmission assessment survey (TAS) methods, measuring antigenemia (Ag) prevalence in children, were used to determine whether prevalence was below a level where recrudescence is unlikely to occur. RESULTS: The highest baseline LF prevalence was found in the Central Valley region. The MDA implementation activities scaled up to cover 45 districts, representing the majority of the endemic population, with drug coverage rates ranging from 60.0% to 98.5%. Challenges related to drug supply and local conflict were reported, and interrupted MDA in some districts. Overall, significant reductions in LF prevalence were found, especially after the first 2 to 3 rounds of MDA, which was supported by the corresponding model. The TAS activities in five districts found only two Ag positive children, resulting in all districts passing the critical threshold. CONCLUSION: Overall, the Myanmar NPELF has made positive steps forward in the elimination of LF despite several challenges, however, it needs to maintain momentum, drawing on international stakeholder support, to aim towards the national and global goals of elimination. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s40249-018-0420-9) contains supplementary material, which is available to authorized users. BioMed Central 2018-05-31 /pmc/articles/PMC5984392/ /pubmed/29855355 http://dx.doi.org/10.1186/s40249-018-0420-9 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Aye, Ni Ni Lin, Zaw Lon, Khin Nan Linn, Nay Yi Yi Nwe, Thet Wai Mon, Khin Mon Ramaiah, Kapa Betts, Hannah Kelly-Hope, Louise A. Mapping and modelling the impact of mass drug adminstration on filariasis prevalence in Myanmar |
title | Mapping and modelling the impact of mass drug adminstration on filariasis prevalence in Myanmar |
title_full | Mapping and modelling the impact of mass drug adminstration on filariasis prevalence in Myanmar |
title_fullStr | Mapping and modelling the impact of mass drug adminstration on filariasis prevalence in Myanmar |
title_full_unstemmed | Mapping and modelling the impact of mass drug adminstration on filariasis prevalence in Myanmar |
title_short | Mapping and modelling the impact of mass drug adminstration on filariasis prevalence in Myanmar |
title_sort | mapping and modelling the impact of mass drug adminstration on filariasis prevalence in myanmar |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5984392/ https://www.ncbi.nlm.nih.gov/pubmed/29855355 http://dx.doi.org/10.1186/s40249-018-0420-9 |
work_keys_str_mv | AT ayenini mappingandmodellingtheimpactofmassdrugadminstrationonfilariasisprevalenceinmyanmar AT linzaw mappingandmodellingtheimpactofmassdrugadminstrationonfilariasisprevalenceinmyanmar AT lonkhinnan mappingandmodellingtheimpactofmassdrugadminstrationonfilariasisprevalenceinmyanmar AT linnnayyiyi mappingandmodellingtheimpactofmassdrugadminstrationonfilariasisprevalenceinmyanmar AT nwethetwai mappingandmodellingtheimpactofmassdrugadminstrationonfilariasisprevalenceinmyanmar AT monkhinmon mappingandmodellingtheimpactofmassdrugadminstrationonfilariasisprevalenceinmyanmar AT ramaiahkapa mappingandmodellingtheimpactofmassdrugadminstrationonfilariasisprevalenceinmyanmar AT bettshannah mappingandmodellingtheimpactofmassdrugadminstrationonfilariasisprevalenceinmyanmar AT kellyhopelouisea mappingandmodellingtheimpactofmassdrugadminstrationonfilariasisprevalenceinmyanmar |