Cargando…

The diagnostic test accuracy of rectal examination for prostate cancer diagnosis in symptomatic patients: a systematic review

BACKGROUND: Prostate cancer is the most common cancer in men in the UK. NICE guidelines on recognition and referral of suspected cancer, recommend performing digital rectal examination (DRE) on patients with urinary symptoms and urgently referring if the prostate feels malignant. However, this is ba...

Descripción completa

Detalles Bibliográficos
Autores principales: Jones, Daniel, Friend, Charlotte, Dreher, Andreas, Allgar, Victoria, Macleod, Una
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5985061/
https://www.ncbi.nlm.nih.gov/pubmed/29859531
http://dx.doi.org/10.1186/s12875-018-0765-y
_version_ 1783328696022597632
author Jones, Daniel
Friend, Charlotte
Dreher, Andreas
Allgar, Victoria
Macleod, Una
author_facet Jones, Daniel
Friend, Charlotte
Dreher, Andreas
Allgar, Victoria
Macleod, Una
author_sort Jones, Daniel
collection PubMed
description BACKGROUND: Prostate cancer is the most common cancer in men in the UK. NICE guidelines on recognition and referral of suspected cancer, recommend performing digital rectal examination (DRE) on patients with urinary symptoms and urgently referring if the prostate feels malignant. However, this is based on the results of one case control study, so it is not known if DRE performed in primary care is an accurate method of detecting prostate cancer. METHODS: The aim of this review is to ascertain the sensitivity, specificity, positive and negative predictive value of DRE for the detection of prostate cancer in symptomatic patients in primary care. CENTRAL, MEDLINE, EMBASE and CINAHL databases were searched in august 2015 for studies in which a DRE was performed in primary care on symptomatic patients and compared against a reference diagnostic procedure. RESULTS: Four studies were included with a total of 3225 patients. The sensitivity and specificity for DRE as a predictor of prostate cancer in symptomatic patients was 28.6 and 90.7%, respectively. The positive and negative predictive values were 42.3 and 84.2%, respectively. CONCLUSION: This review found that DRE performed in general practice is accurate, and supports the UK NICE guidelines that patients with a malignant prostate on examination are referred urgently for suspected prostate cancer. Abnormal DRE carried a 42.3% chance of malignancy, above the 3% risk threshold which NICE guidance suggests warrants an urgent referral. However this review questions the benefit of performing a DRE in primary care in the first instance, suggesting that a patient’s risk of prostate cancer based on symptoms alone would warrant urgent referral even if the DRE feels normal.
format Online
Article
Text
id pubmed-5985061
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-59850612018-06-07 The diagnostic test accuracy of rectal examination for prostate cancer diagnosis in symptomatic patients: a systematic review Jones, Daniel Friend, Charlotte Dreher, Andreas Allgar, Victoria Macleod, Una BMC Fam Pract Research Article BACKGROUND: Prostate cancer is the most common cancer in men in the UK. NICE guidelines on recognition and referral of suspected cancer, recommend performing digital rectal examination (DRE) on patients with urinary symptoms and urgently referring if the prostate feels malignant. However, this is based on the results of one case control study, so it is not known if DRE performed in primary care is an accurate method of detecting prostate cancer. METHODS: The aim of this review is to ascertain the sensitivity, specificity, positive and negative predictive value of DRE for the detection of prostate cancer in symptomatic patients in primary care. CENTRAL, MEDLINE, EMBASE and CINAHL databases were searched in august 2015 for studies in which a DRE was performed in primary care on symptomatic patients and compared against a reference diagnostic procedure. RESULTS: Four studies were included with a total of 3225 patients. The sensitivity and specificity for DRE as a predictor of prostate cancer in symptomatic patients was 28.6 and 90.7%, respectively. The positive and negative predictive values were 42.3 and 84.2%, respectively. CONCLUSION: This review found that DRE performed in general practice is accurate, and supports the UK NICE guidelines that patients with a malignant prostate on examination are referred urgently for suspected prostate cancer. Abnormal DRE carried a 42.3% chance of malignancy, above the 3% risk threshold which NICE guidance suggests warrants an urgent referral. However this review questions the benefit of performing a DRE in primary care in the first instance, suggesting that a patient’s risk of prostate cancer based on symptoms alone would warrant urgent referral even if the DRE feels normal. BioMed Central 2018-06-02 /pmc/articles/PMC5985061/ /pubmed/29859531 http://dx.doi.org/10.1186/s12875-018-0765-y Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Jones, Daniel
Friend, Charlotte
Dreher, Andreas
Allgar, Victoria
Macleod, Una
The diagnostic test accuracy of rectal examination for prostate cancer diagnosis in symptomatic patients: a systematic review
title The diagnostic test accuracy of rectal examination for prostate cancer diagnosis in symptomatic patients: a systematic review
title_full The diagnostic test accuracy of rectal examination for prostate cancer diagnosis in symptomatic patients: a systematic review
title_fullStr The diagnostic test accuracy of rectal examination for prostate cancer diagnosis in symptomatic patients: a systematic review
title_full_unstemmed The diagnostic test accuracy of rectal examination for prostate cancer diagnosis in symptomatic patients: a systematic review
title_short The diagnostic test accuracy of rectal examination for prostate cancer diagnosis in symptomatic patients: a systematic review
title_sort diagnostic test accuracy of rectal examination for prostate cancer diagnosis in symptomatic patients: a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5985061/
https://www.ncbi.nlm.nih.gov/pubmed/29859531
http://dx.doi.org/10.1186/s12875-018-0765-y
work_keys_str_mv AT jonesdaniel thediagnostictestaccuracyofrectalexaminationforprostatecancerdiagnosisinsymptomaticpatientsasystematicreview
AT friendcharlotte thediagnostictestaccuracyofrectalexaminationforprostatecancerdiagnosisinsymptomaticpatientsasystematicreview
AT dreherandreas thediagnostictestaccuracyofrectalexaminationforprostatecancerdiagnosisinsymptomaticpatientsasystematicreview
AT allgarvictoria thediagnostictestaccuracyofrectalexaminationforprostatecancerdiagnosisinsymptomaticpatientsasystematicreview
AT macleoduna thediagnostictestaccuracyofrectalexaminationforprostatecancerdiagnosisinsymptomaticpatientsasystematicreview
AT jonesdaniel diagnostictestaccuracyofrectalexaminationforprostatecancerdiagnosisinsymptomaticpatientsasystematicreview
AT friendcharlotte diagnostictestaccuracyofrectalexaminationforprostatecancerdiagnosisinsymptomaticpatientsasystematicreview
AT dreherandreas diagnostictestaccuracyofrectalexaminationforprostatecancerdiagnosisinsymptomaticpatientsasystematicreview
AT allgarvictoria diagnostictestaccuracyofrectalexaminationforprostatecancerdiagnosisinsymptomaticpatientsasystematicreview
AT macleoduna diagnostictestaccuracyofrectalexaminationforprostatecancerdiagnosisinsymptomaticpatientsasystematicreview