Cargando…
Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48
Defects in DNA repair can cause various genetic diseases with severe pathological phenotypes. Fanconi anemia (FA) is a rare disease characterized by bone marrow failure, developmental abnormalities, and increased cancer risk that is caused by defective repair of DNA interstrand crosslinks (ICLs). He...
Autores principales: | , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5996029/ https://www.ncbi.nlm.nih.gov/pubmed/29891926 http://dx.doi.org/10.1038/s41467-018-04649-z |
_version_ | 1783330739862896640 |
---|---|
author | Velimezi, Georgia Robinson-Garcia, Lydia Muñoz-Martínez, Francisco Wiegant, Wouter W. Ferreira da Silva, Joana Owusu, Michel Moder, Martin Wiedner, Marc Rosenthal, Sara Brin Fisch, Kathleen M. Moffat, Jason Menche, Jörg van Attikum, Haico Jackson, Stephen P. Loizou, Joanna I. |
author_facet | Velimezi, Georgia Robinson-Garcia, Lydia Muñoz-Martínez, Francisco Wiegant, Wouter W. Ferreira da Silva, Joana Owusu, Michel Moder, Martin Wiedner, Marc Rosenthal, Sara Brin Fisch, Kathleen M. Moffat, Jason Menche, Jörg van Attikum, Haico Jackson, Stephen P. Loizou, Joanna I. |
author_sort | Velimezi, Georgia |
collection | PubMed |
description | Defects in DNA repair can cause various genetic diseases with severe pathological phenotypes. Fanconi anemia (FA) is a rare disease characterized by bone marrow failure, developmental abnormalities, and increased cancer risk that is caused by defective repair of DNA interstrand crosslinks (ICLs). Here, we identify the deubiquitylating enzyme USP48 as synthetic viable for FA-gene deficiencies by performing genome-wide loss-of-function screens across a panel of human haploid isogenic FA-defective cells (FANCA, FANCC, FANCG, FANCI, FANCD2). Thus, as compared to FA-defective cells alone, FA-deficient cells additionally lacking USP48 are less sensitive to genotoxic stress induced by ICL agents and display enhanced, BRCA1-dependent, clearance of DNA damage. Consequently, USP48 inactivation reduces chromosomal instability of FA-defective cells. Our results highlight a role for USP48 in controlling DNA repair and suggest it as a potential target that could be therapeutically exploited for FA. |
format | Online Article Text |
id | pubmed-5996029 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-59960292018-06-13 Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48 Velimezi, Georgia Robinson-Garcia, Lydia Muñoz-Martínez, Francisco Wiegant, Wouter W. Ferreira da Silva, Joana Owusu, Michel Moder, Martin Wiedner, Marc Rosenthal, Sara Brin Fisch, Kathleen M. Moffat, Jason Menche, Jörg van Attikum, Haico Jackson, Stephen P. Loizou, Joanna I. Nat Commun Article Defects in DNA repair can cause various genetic diseases with severe pathological phenotypes. Fanconi anemia (FA) is a rare disease characterized by bone marrow failure, developmental abnormalities, and increased cancer risk that is caused by defective repair of DNA interstrand crosslinks (ICLs). Here, we identify the deubiquitylating enzyme USP48 as synthetic viable for FA-gene deficiencies by performing genome-wide loss-of-function screens across a panel of human haploid isogenic FA-defective cells (FANCA, FANCC, FANCG, FANCI, FANCD2). Thus, as compared to FA-defective cells alone, FA-deficient cells additionally lacking USP48 are less sensitive to genotoxic stress induced by ICL agents and display enhanced, BRCA1-dependent, clearance of DNA damage. Consequently, USP48 inactivation reduces chromosomal instability of FA-defective cells. Our results highlight a role for USP48 in controlling DNA repair and suggest it as a potential target that could be therapeutically exploited for FA. Nature Publishing Group UK 2018-06-11 /pmc/articles/PMC5996029/ /pubmed/29891926 http://dx.doi.org/10.1038/s41467-018-04649-z Text en © The Author(s) 2018 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Velimezi, Georgia Robinson-Garcia, Lydia Muñoz-Martínez, Francisco Wiegant, Wouter W. Ferreira da Silva, Joana Owusu, Michel Moder, Martin Wiedner, Marc Rosenthal, Sara Brin Fisch, Kathleen M. Moffat, Jason Menche, Jörg van Attikum, Haico Jackson, Stephen P. Loizou, Joanna I. Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48 |
title | Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48 |
title_full | Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48 |
title_fullStr | Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48 |
title_full_unstemmed | Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48 |
title_short | Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48 |
title_sort | map of synthetic rescue interactions for the fanconi anemia dna repair pathway identifies usp48 |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5996029/ https://www.ncbi.nlm.nih.gov/pubmed/29891926 http://dx.doi.org/10.1038/s41467-018-04649-z |
work_keys_str_mv | AT velimezigeorgia mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT robinsongarcialydia mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT munozmartinezfrancisco mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT wiegantwouterw mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT ferreiradasilvajoana mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT owusumichel mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT modermartin mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT wiednermarc mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT rosenthalsarabrin mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT fischkathleenm mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT moffatjason mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT menchejorg mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT vanattikumhaico mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT jacksonstephenp mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 AT loizoujoannai mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48 |