Cargando…

Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48

Defects in DNA repair can cause various genetic diseases with severe pathological phenotypes. Fanconi anemia (FA) is a rare disease characterized by bone marrow failure, developmental abnormalities, and increased cancer risk that is caused by defective repair of DNA interstrand crosslinks (ICLs). He...

Descripción completa

Detalles Bibliográficos
Autores principales: Velimezi, Georgia, Robinson-Garcia, Lydia, Muñoz-Martínez, Francisco, Wiegant, Wouter W., Ferreira da Silva, Joana, Owusu, Michel, Moder, Martin, Wiedner, Marc, Rosenthal, Sara Brin, Fisch, Kathleen M., Moffat, Jason, Menche, Jörg, van Attikum, Haico, Jackson, Stephen P., Loizou, Joanna I.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5996029/
https://www.ncbi.nlm.nih.gov/pubmed/29891926
http://dx.doi.org/10.1038/s41467-018-04649-z
_version_ 1783330739862896640
author Velimezi, Georgia
Robinson-Garcia, Lydia
Muñoz-Martínez, Francisco
Wiegant, Wouter W.
Ferreira da Silva, Joana
Owusu, Michel
Moder, Martin
Wiedner, Marc
Rosenthal, Sara Brin
Fisch, Kathleen M.
Moffat, Jason
Menche, Jörg
van Attikum, Haico
Jackson, Stephen P.
Loizou, Joanna I.
author_facet Velimezi, Georgia
Robinson-Garcia, Lydia
Muñoz-Martínez, Francisco
Wiegant, Wouter W.
Ferreira da Silva, Joana
Owusu, Michel
Moder, Martin
Wiedner, Marc
Rosenthal, Sara Brin
Fisch, Kathleen M.
Moffat, Jason
Menche, Jörg
van Attikum, Haico
Jackson, Stephen P.
Loizou, Joanna I.
author_sort Velimezi, Georgia
collection PubMed
description Defects in DNA repair can cause various genetic diseases with severe pathological phenotypes. Fanconi anemia (FA) is a rare disease characterized by bone marrow failure, developmental abnormalities, and increased cancer risk that is caused by defective repair of DNA interstrand crosslinks (ICLs). Here, we identify the deubiquitylating enzyme USP48 as synthetic viable for FA-gene deficiencies by performing genome-wide loss-of-function screens across a panel of human haploid isogenic FA-defective cells (FANCA, FANCC, FANCG, FANCI, FANCD2). Thus, as compared to FA-defective cells alone, FA-deficient cells additionally lacking USP48 are less sensitive to genotoxic stress induced by ICL agents and display enhanced, BRCA1-dependent, clearance of DNA damage. Consequently, USP48 inactivation reduces chromosomal instability of FA-defective cells. Our results highlight a role for USP48 in controlling DNA repair and suggest it as a potential target that could be therapeutically exploited for FA.
format Online
Article
Text
id pubmed-5996029
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-59960292018-06-13 Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48 Velimezi, Georgia Robinson-Garcia, Lydia Muñoz-Martínez, Francisco Wiegant, Wouter W. Ferreira da Silva, Joana Owusu, Michel Moder, Martin Wiedner, Marc Rosenthal, Sara Brin Fisch, Kathleen M. Moffat, Jason Menche, Jörg van Attikum, Haico Jackson, Stephen P. Loizou, Joanna I. Nat Commun Article Defects in DNA repair can cause various genetic diseases with severe pathological phenotypes. Fanconi anemia (FA) is a rare disease characterized by bone marrow failure, developmental abnormalities, and increased cancer risk that is caused by defective repair of DNA interstrand crosslinks (ICLs). Here, we identify the deubiquitylating enzyme USP48 as synthetic viable for FA-gene deficiencies by performing genome-wide loss-of-function screens across a panel of human haploid isogenic FA-defective cells (FANCA, FANCC, FANCG, FANCI, FANCD2). Thus, as compared to FA-defective cells alone, FA-deficient cells additionally lacking USP48 are less sensitive to genotoxic stress induced by ICL agents and display enhanced, BRCA1-dependent, clearance of DNA damage. Consequently, USP48 inactivation reduces chromosomal instability of FA-defective cells. Our results highlight a role for USP48 in controlling DNA repair and suggest it as a potential target that could be therapeutically exploited for FA. Nature Publishing Group UK 2018-06-11 /pmc/articles/PMC5996029/ /pubmed/29891926 http://dx.doi.org/10.1038/s41467-018-04649-z Text en © The Author(s) 2018 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
spellingShingle Article
Velimezi, Georgia
Robinson-Garcia, Lydia
Muñoz-Martínez, Francisco
Wiegant, Wouter W.
Ferreira da Silva, Joana
Owusu, Michel
Moder, Martin
Wiedner, Marc
Rosenthal, Sara Brin
Fisch, Kathleen M.
Moffat, Jason
Menche, Jörg
van Attikum, Haico
Jackson, Stephen P.
Loizou, Joanna I.
Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48
title Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48
title_full Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48
title_fullStr Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48
title_full_unstemmed Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48
title_short Map of synthetic rescue interactions for the Fanconi anemia DNA repair pathway identifies USP48
title_sort map of synthetic rescue interactions for the fanconi anemia dna repair pathway identifies usp48
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5996029/
https://www.ncbi.nlm.nih.gov/pubmed/29891926
http://dx.doi.org/10.1038/s41467-018-04649-z
work_keys_str_mv AT velimezigeorgia mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT robinsongarcialydia mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT munozmartinezfrancisco mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT wiegantwouterw mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT ferreiradasilvajoana mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT owusumichel mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT modermartin mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT wiednermarc mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT rosenthalsarabrin mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT fischkathleenm mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT moffatjason mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT menchejorg mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT vanattikumhaico mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT jacksonstephenp mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48
AT loizoujoannai mapofsyntheticrescueinteractionsforthefanconianemiadnarepairpathwayidentifiesusp48