Cargando…

Cost-effectiveness of diagnostic and therapeutic interventions for chronic hepatitis C: a systematic review of model-based analyses

BACKGROUND: Decisions about which subgroup of chronic hepatitis C (CHC) patients should be treated with direct acting anti-viral agents (DAAs) have economic importance due to high drug prices. Treat-all DAA strategies for CHC have gained acceptance despite high drug acquisition costs. However, there...

Descripción completa

Detalles Bibliográficos
Autores principales: Castro, Rodolfo, Crathorne, Louise, Perazzo, Hugo, Silva, Julio, Cooper, Chris, Varley-Campbell, Jo, Marinho, Daniel Savignon, Haasova, Marcela, Veloso, Valdilea G., Anderson, Rob, Hyde, Chris
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5998601/
https://www.ncbi.nlm.nih.gov/pubmed/29895281
http://dx.doi.org/10.1186/s12874-018-0515-9
_version_ 1783331263085543424
author Castro, Rodolfo
Crathorne, Louise
Perazzo, Hugo
Silva, Julio
Cooper, Chris
Varley-Campbell, Jo
Marinho, Daniel Savignon
Haasova, Marcela
Veloso, Valdilea G.
Anderson, Rob
Hyde, Chris
author_facet Castro, Rodolfo
Crathorne, Louise
Perazzo, Hugo
Silva, Julio
Cooper, Chris
Varley-Campbell, Jo
Marinho, Daniel Savignon
Haasova, Marcela
Veloso, Valdilea G.
Anderson, Rob
Hyde, Chris
author_sort Castro, Rodolfo
collection PubMed
description BACKGROUND: Decisions about which subgroup of chronic hepatitis C (CHC) patients should be treated with direct acting anti-viral agents (DAAs) have economic importance due to high drug prices. Treat-all DAA strategies for CHC have gained acceptance despite high drug acquisition costs. However, there are also costs associated with the surveillance of CHC to determine a subgroup of patients with significant impairment. The aim of this systematic review was to describe the modelling methods used and summarise results in cost-effectiveness analyses (CEAs) of both CHC treatment with DAAs and surveillance of liver disease. METHODS: Electronic databases including Embase and Medline were searched from inception to May 2015. Eligible studies included models predicting costs and/or outcomes for interventions, surveillance, or management of people with CHC. Narrative and quantitative synthesis were conducted. Quality appraisal was conducted using validated checklists. The review was conducted following principles published by NHS Centre for Research and Dissemination. RESULTS: Forty-one CEAs met the eligibility criteria for the review; 37 evaluated an intervention and four evaluated surveillance strategies for targeting DAA treatment to those likely to gain most benefit. Included studies were of variable quality mostly due to reporting omissions. Of the 37 CEAs, eight models that enabled comparative analysis were fully appraised and synthesized. These models provided non-unique cost-effectiveness estimates in a specific DAA comparison in a specific population defined in terms of genotype, prior treatment status, and presence or absence of cirrhosis. Marked heterogeneity in cost-effectiveness estimates was observed despite this stratification. Approximately half of the estimates suggested that DAAs were cost-effective considering a threshold of US$30,000 and 73% with threshold of US$50,000. Two models evaluating surveillance strategies suggested that treating all CHC patients regardless of the staging of liver disease could be cost-effective. CONCLUSIONS: CEAs of CHC treatments need to better account for variability in their estimates. This analysis suggested that there are still circumstances where DAAs are not cost-effective. Surveillance in place of a treat-all strategy may still need to be considered as an option for deploying DAAs, particularly where acquisition cost is at the limit of affordability for a given health system. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12874-018-0515-9) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5998601
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-59986012018-06-25 Cost-effectiveness of diagnostic and therapeutic interventions for chronic hepatitis C: a systematic review of model-based analyses Castro, Rodolfo Crathorne, Louise Perazzo, Hugo Silva, Julio Cooper, Chris Varley-Campbell, Jo Marinho, Daniel Savignon Haasova, Marcela Veloso, Valdilea G. Anderson, Rob Hyde, Chris BMC Med Res Methodol Research Article BACKGROUND: Decisions about which subgroup of chronic hepatitis C (CHC) patients should be treated with direct acting anti-viral agents (DAAs) have economic importance due to high drug prices. Treat-all DAA strategies for CHC have gained acceptance despite high drug acquisition costs. However, there are also costs associated with the surveillance of CHC to determine a subgroup of patients with significant impairment. The aim of this systematic review was to describe the modelling methods used and summarise results in cost-effectiveness analyses (CEAs) of both CHC treatment with DAAs and surveillance of liver disease. METHODS: Electronic databases including Embase and Medline were searched from inception to May 2015. Eligible studies included models predicting costs and/or outcomes for interventions, surveillance, or management of people with CHC. Narrative and quantitative synthesis were conducted. Quality appraisal was conducted using validated checklists. The review was conducted following principles published by NHS Centre for Research and Dissemination. RESULTS: Forty-one CEAs met the eligibility criteria for the review; 37 evaluated an intervention and four evaluated surveillance strategies for targeting DAA treatment to those likely to gain most benefit. Included studies were of variable quality mostly due to reporting omissions. Of the 37 CEAs, eight models that enabled comparative analysis were fully appraised and synthesized. These models provided non-unique cost-effectiveness estimates in a specific DAA comparison in a specific population defined in terms of genotype, prior treatment status, and presence or absence of cirrhosis. Marked heterogeneity in cost-effectiveness estimates was observed despite this stratification. Approximately half of the estimates suggested that DAAs were cost-effective considering a threshold of US$30,000 and 73% with threshold of US$50,000. Two models evaluating surveillance strategies suggested that treating all CHC patients regardless of the staging of liver disease could be cost-effective. CONCLUSIONS: CEAs of CHC treatments need to better account for variability in their estimates. This analysis suggested that there are still circumstances where DAAs are not cost-effective. Surveillance in place of a treat-all strategy may still need to be considered as an option for deploying DAAs, particularly where acquisition cost is at the limit of affordability for a given health system. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12874-018-0515-9) contains supplementary material, which is available to authorized users. BioMed Central 2018-06-13 /pmc/articles/PMC5998601/ /pubmed/29895281 http://dx.doi.org/10.1186/s12874-018-0515-9 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Castro, Rodolfo
Crathorne, Louise
Perazzo, Hugo
Silva, Julio
Cooper, Chris
Varley-Campbell, Jo
Marinho, Daniel Savignon
Haasova, Marcela
Veloso, Valdilea G.
Anderson, Rob
Hyde, Chris
Cost-effectiveness of diagnostic and therapeutic interventions for chronic hepatitis C: a systematic review of model-based analyses
title Cost-effectiveness of diagnostic and therapeutic interventions for chronic hepatitis C: a systematic review of model-based analyses
title_full Cost-effectiveness of diagnostic and therapeutic interventions for chronic hepatitis C: a systematic review of model-based analyses
title_fullStr Cost-effectiveness of diagnostic and therapeutic interventions for chronic hepatitis C: a systematic review of model-based analyses
title_full_unstemmed Cost-effectiveness of diagnostic and therapeutic interventions for chronic hepatitis C: a systematic review of model-based analyses
title_short Cost-effectiveness of diagnostic and therapeutic interventions for chronic hepatitis C: a systematic review of model-based analyses
title_sort cost-effectiveness of diagnostic and therapeutic interventions for chronic hepatitis c: a systematic review of model-based analyses
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5998601/
https://www.ncbi.nlm.nih.gov/pubmed/29895281
http://dx.doi.org/10.1186/s12874-018-0515-9
work_keys_str_mv AT castrorodolfo costeffectivenessofdiagnosticandtherapeuticinterventionsforchronichepatitiscasystematicreviewofmodelbasedanalyses
AT crathornelouise costeffectivenessofdiagnosticandtherapeuticinterventionsforchronichepatitiscasystematicreviewofmodelbasedanalyses
AT perazzohugo costeffectivenessofdiagnosticandtherapeuticinterventionsforchronichepatitiscasystematicreviewofmodelbasedanalyses
AT silvajulio costeffectivenessofdiagnosticandtherapeuticinterventionsforchronichepatitiscasystematicreviewofmodelbasedanalyses
AT cooperchris costeffectivenessofdiagnosticandtherapeuticinterventionsforchronichepatitiscasystematicreviewofmodelbasedanalyses
AT varleycampbelljo costeffectivenessofdiagnosticandtherapeuticinterventionsforchronichepatitiscasystematicreviewofmodelbasedanalyses
AT marinhodanielsavignon costeffectivenessofdiagnosticandtherapeuticinterventionsforchronichepatitiscasystematicreviewofmodelbasedanalyses
AT haasovamarcela costeffectivenessofdiagnosticandtherapeuticinterventionsforchronichepatitiscasystematicreviewofmodelbasedanalyses
AT velosovaldileag costeffectivenessofdiagnosticandtherapeuticinterventionsforchronichepatitiscasystematicreviewofmodelbasedanalyses
AT andersonrob costeffectivenessofdiagnosticandtherapeuticinterventionsforchronichepatitiscasystematicreviewofmodelbasedanalyses
AT hydechris costeffectivenessofdiagnosticandtherapeuticinterventionsforchronichepatitiscasystematicreviewofmodelbasedanalyses