Cargando…
Effect of Skin Model on In Vitro Performance of an Adhesive Dermally Applied Microarray Coated with Zolmitriptan
Franz cell studies, utilizing different human skin and an artificial membrane, evaluating the influence of skin model on permeation of zolmitriptan coated on an array of titanium microprojections, were evaluated. Full thickness and dermatomed ex vivo human skin, as well as a synthetic hydrophobic me...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6008839/ https://www.ncbi.nlm.nih.gov/pubmed/29974005 http://dx.doi.org/10.1155/2018/7459124 |
_version_ | 1783333261661962240 |
---|---|
author | Ameri, Mahmoud Lewis, Hayley Lehman, Paul |
author_facet | Ameri, Mahmoud Lewis, Hayley Lehman, Paul |
author_sort | Ameri, Mahmoud |
collection | PubMed |
description | Franz cell studies, utilizing different human skin and an artificial membrane, evaluating the influence of skin model on permeation of zolmitriptan coated on an array of titanium microprojections, were evaluated. Full thickness and dermatomed ex vivo human skin, as well as a synthetic hydrophobic membrane (Strat-M®), were assessed. It was found that the choice of model demonstrated different absorption kinetics for the permeation of zolmitriptan. For the synthetic membrane only 11% of the zolmitriptan coated dose permeated into the receptor media, whilst for the dermatomed skin 85% permeated into the receptor. The permeation of zolmitriptan through full thickness skin had a significantly different absorption profile and time to maximum flux in comparison to the dermatomed skin and synthetic model. On the basis of these results dermatomed skin may be a better estimate of in vivo performance of drug-coated metallic microprojections. |
format | Online Article Text |
id | pubmed-6008839 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-60088392018-07-04 Effect of Skin Model on In Vitro Performance of an Adhesive Dermally Applied Microarray Coated with Zolmitriptan Ameri, Mahmoud Lewis, Hayley Lehman, Paul J Pharm (Cairo) Research Article Franz cell studies, utilizing different human skin and an artificial membrane, evaluating the influence of skin model on permeation of zolmitriptan coated on an array of titanium microprojections, were evaluated. Full thickness and dermatomed ex vivo human skin, as well as a synthetic hydrophobic membrane (Strat-M®), were assessed. It was found that the choice of model demonstrated different absorption kinetics for the permeation of zolmitriptan. For the synthetic membrane only 11% of the zolmitriptan coated dose permeated into the receptor media, whilst for the dermatomed skin 85% permeated into the receptor. The permeation of zolmitriptan through full thickness skin had a significantly different absorption profile and time to maximum flux in comparison to the dermatomed skin and synthetic model. On the basis of these results dermatomed skin may be a better estimate of in vivo performance of drug-coated metallic microprojections. Hindawi 2018-06-03 /pmc/articles/PMC6008839/ /pubmed/29974005 http://dx.doi.org/10.1155/2018/7459124 Text en Copyright © 2018 Mahmoud Ameri et al. https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Ameri, Mahmoud Lewis, Hayley Lehman, Paul Effect of Skin Model on In Vitro Performance of an Adhesive Dermally Applied Microarray Coated with Zolmitriptan |
title | Effect of Skin Model on In Vitro Performance of an Adhesive Dermally Applied Microarray Coated with Zolmitriptan |
title_full | Effect of Skin Model on In Vitro Performance of an Adhesive Dermally Applied Microarray Coated with Zolmitriptan |
title_fullStr | Effect of Skin Model on In Vitro Performance of an Adhesive Dermally Applied Microarray Coated with Zolmitriptan |
title_full_unstemmed | Effect of Skin Model on In Vitro Performance of an Adhesive Dermally Applied Microarray Coated with Zolmitriptan |
title_short | Effect of Skin Model on In Vitro Performance of an Adhesive Dermally Applied Microarray Coated with Zolmitriptan |
title_sort | effect of skin model on in vitro performance of an adhesive dermally applied microarray coated with zolmitriptan |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6008839/ https://www.ncbi.nlm.nih.gov/pubmed/29974005 http://dx.doi.org/10.1155/2018/7459124 |
work_keys_str_mv | AT amerimahmoud effectofskinmodeloninvitroperformanceofanadhesivedermallyappliedmicroarraycoatedwithzolmitriptan AT lewishayley effectofskinmodeloninvitroperformanceofanadhesivedermallyappliedmicroarraycoatedwithzolmitriptan AT lehmanpaul effectofskinmodeloninvitroperformanceofanadhesivedermallyappliedmicroarraycoatedwithzolmitriptan |