Cargando…
Pathway-Wide Genetic Risks in Chlamydial Infections Overlap between Tissue Tropisms: A Genome-Wide Association Scan
Chlamydia trachomatis is the most commonly diagnosed bacterial sexually transmitted infection and can lead to tubal factor infertility, a disease characterised by fibrosis of the fallopian tubes. Genetic polymorphisms in molecular pathways involving G protein-coupled receptor signalling, the Akt/PI3...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6008910/ https://www.ncbi.nlm.nih.gov/pubmed/29967566 http://dx.doi.org/10.1155/2018/3434101 |
_version_ | 1783333275318616064 |
---|---|
author | Roberts, Chrissy H. Ouburg, Sander Preston, Mark D. de Vries, Henry J. C. Holland, Martin J. Morré, Servaas A. |
author_facet | Roberts, Chrissy H. Ouburg, Sander Preston, Mark D. de Vries, Henry J. C. Holland, Martin J. Morré, Servaas A. |
author_sort | Roberts, Chrissy H. |
collection | PubMed |
description | Chlamydia trachomatis is the most commonly diagnosed bacterial sexually transmitted infection and can lead to tubal factor infertility, a disease characterised by fibrosis of the fallopian tubes. Genetic polymorphisms in molecular pathways involving G protein-coupled receptor signalling, the Akt/PI3K cascade, the mitotic cell cycle, and immune response have been identified in association with the development of trachomatous scarring, an ocular form of chlamydia-related fibrotic pathology. In this case-control study, we performed genome-wide association and pathways-based analysis in a sample of 71 Dutch women who attended an STI clinic who were seropositive for Chlamydia trachomatis antibodies and 169 high-risk Dutch women who sought similar health services but who were seronegative. We identified two regions of within-gene SNP association with Chlamydia trachomatis serological response and found that GPCR signalling and cell cycle pathways were also associated with the trait. These pathway-level associations appear to be common to immunological sequelae of chlamydial infections in both ocular and urogenital tropisms. These pathways may be central mediators of human refractoriness to chlamydial diseases. |
format | Online Article Text |
id | pubmed-6008910 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-60089102018-07-02 Pathway-Wide Genetic Risks in Chlamydial Infections Overlap between Tissue Tropisms: A Genome-Wide Association Scan Roberts, Chrissy H. Ouburg, Sander Preston, Mark D. de Vries, Henry J. C. Holland, Martin J. Morré, Servaas A. Mediators Inflamm Research Article Chlamydia trachomatis is the most commonly diagnosed bacterial sexually transmitted infection and can lead to tubal factor infertility, a disease characterised by fibrosis of the fallopian tubes. Genetic polymorphisms in molecular pathways involving G protein-coupled receptor signalling, the Akt/PI3K cascade, the mitotic cell cycle, and immune response have been identified in association with the development of trachomatous scarring, an ocular form of chlamydia-related fibrotic pathology. In this case-control study, we performed genome-wide association and pathways-based analysis in a sample of 71 Dutch women who attended an STI clinic who were seropositive for Chlamydia trachomatis antibodies and 169 high-risk Dutch women who sought similar health services but who were seronegative. We identified two regions of within-gene SNP association with Chlamydia trachomatis serological response and found that GPCR signalling and cell cycle pathways were also associated with the trait. These pathway-level associations appear to be common to immunological sequelae of chlamydial infections in both ocular and urogenital tropisms. These pathways may be central mediators of human refractoriness to chlamydial diseases. Hindawi 2018-06-03 /pmc/articles/PMC6008910/ /pubmed/29967566 http://dx.doi.org/10.1155/2018/3434101 Text en Copyright © 2018 Chrissy H. Roberts et al. http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Roberts, Chrissy H. Ouburg, Sander Preston, Mark D. de Vries, Henry J. C. Holland, Martin J. Morré, Servaas A. Pathway-Wide Genetic Risks in Chlamydial Infections Overlap between Tissue Tropisms: A Genome-Wide Association Scan |
title | Pathway-Wide Genetic Risks in Chlamydial Infections Overlap between Tissue Tropisms: A Genome-Wide Association Scan |
title_full | Pathway-Wide Genetic Risks in Chlamydial Infections Overlap between Tissue Tropisms: A Genome-Wide Association Scan |
title_fullStr | Pathway-Wide Genetic Risks in Chlamydial Infections Overlap between Tissue Tropisms: A Genome-Wide Association Scan |
title_full_unstemmed | Pathway-Wide Genetic Risks in Chlamydial Infections Overlap between Tissue Tropisms: A Genome-Wide Association Scan |
title_short | Pathway-Wide Genetic Risks in Chlamydial Infections Overlap between Tissue Tropisms: A Genome-Wide Association Scan |
title_sort | pathway-wide genetic risks in chlamydial infections overlap between tissue tropisms: a genome-wide association scan |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6008910/ https://www.ncbi.nlm.nih.gov/pubmed/29967566 http://dx.doi.org/10.1155/2018/3434101 |
work_keys_str_mv | AT robertschrissyh pathwaywidegeneticrisksinchlamydialinfectionsoverlapbetweentissuetropismsagenomewideassociationscan AT ouburgsander pathwaywidegeneticrisksinchlamydialinfectionsoverlapbetweentissuetropismsagenomewideassociationscan AT prestonmarkd pathwaywidegeneticrisksinchlamydialinfectionsoverlapbetweentissuetropismsagenomewideassociationscan AT devrieshenryjc pathwaywidegeneticrisksinchlamydialinfectionsoverlapbetweentissuetropismsagenomewideassociationscan AT hollandmartinj pathwaywidegeneticrisksinchlamydialinfectionsoverlapbetweentissuetropismsagenomewideassociationscan AT morreservaasa pathwaywidegeneticrisksinchlamydialinfectionsoverlapbetweentissuetropismsagenomewideassociationscan |