Cargando…
Decreased MUC1 in endometrium is an independent receptivity marker in recurrent implantation failure during implantation window
BACKGROUND: It is postulated that women suffered from recurrent implantation failure (RIF) have different endometrial receptivity compared to those who experienced with idiopathic recurrent miscarriage (RM). In this study, expression of common endometrial markers Leukemia inhibitor factor (LIF), muc...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6013892/ https://www.ncbi.nlm.nih.gov/pubmed/29929546 http://dx.doi.org/10.1186/s12958-018-0379-1 |
_version_ | 1783334115259449344 |
---|---|
author | Wu, Fangrong Chen, Xiaoyan Liu, Yingyu Liang, Bo Xu, Hui Li, Tin Chiu Wang, Chi Chiu |
author_facet | Wu, Fangrong Chen, Xiaoyan Liu, Yingyu Liang, Bo Xu, Hui Li, Tin Chiu Wang, Chi Chiu |
author_sort | Wu, Fangrong |
collection | PubMed |
description | BACKGROUND: It is postulated that women suffered from recurrent implantation failure (RIF) have different endometrial receptivity compared to those who experienced with idiopathic recurrent miscarriage (RM). In this study, expression of common endometrial markers Leukemia inhibitor factor (LIF), mucin 1 (MUC1) and integrin β3 were studied and compared. METHODS: Fourteen women with RIF, 25 with RM and 20 fertile controls were recruited for endometrial biopsy during implantation window on day LH + 7. Spatial and temporal expression of MUC1, LIF and Integrin β3 were compared using semi-quantitative immunohistochemistry. Association of MUC1, LIF and integrin β3 expression levels with demographic and clinical characteristics were determined. RESULTS: MUC1 expression in both luminal and glandular epithelium in women with RIF were significantly lower than that in women with RM and fertile controls. There were no differences in LIF and Integrin β3 expression in endometrial epithelium among three groups. Decreased MUC1 expression were not significantly associated with age, BMI, gravidity, parity, cycle length, progesterone level and previous miscarriage. CONCLUSIONS: Deceased expression of MUC1 is an independent marker for endometrial receptivity in RIF women, suggesting MUC1 may contribute to the reproductive failure in RIF women. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12958-018-0379-1) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6013892 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-60138922018-07-05 Decreased MUC1 in endometrium is an independent receptivity marker in recurrent implantation failure during implantation window Wu, Fangrong Chen, Xiaoyan Liu, Yingyu Liang, Bo Xu, Hui Li, Tin Chiu Wang, Chi Chiu Reprod Biol Endocrinol Research BACKGROUND: It is postulated that women suffered from recurrent implantation failure (RIF) have different endometrial receptivity compared to those who experienced with idiopathic recurrent miscarriage (RM). In this study, expression of common endometrial markers Leukemia inhibitor factor (LIF), mucin 1 (MUC1) and integrin β3 were studied and compared. METHODS: Fourteen women with RIF, 25 with RM and 20 fertile controls were recruited for endometrial biopsy during implantation window on day LH + 7. Spatial and temporal expression of MUC1, LIF and Integrin β3 were compared using semi-quantitative immunohistochemistry. Association of MUC1, LIF and integrin β3 expression levels with demographic and clinical characteristics were determined. RESULTS: MUC1 expression in both luminal and glandular epithelium in women with RIF were significantly lower than that in women with RM and fertile controls. There were no differences in LIF and Integrin β3 expression in endometrial epithelium among three groups. Decreased MUC1 expression were not significantly associated with age, BMI, gravidity, parity, cycle length, progesterone level and previous miscarriage. CONCLUSIONS: Deceased expression of MUC1 is an independent marker for endometrial receptivity in RIF women, suggesting MUC1 may contribute to the reproductive failure in RIF women. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12958-018-0379-1) contains supplementary material, which is available to authorized users. BioMed Central 2018-06-21 /pmc/articles/PMC6013892/ /pubmed/29929546 http://dx.doi.org/10.1186/s12958-018-0379-1 Text en © The Author(s). 2018 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Wu, Fangrong Chen, Xiaoyan Liu, Yingyu Liang, Bo Xu, Hui Li, Tin Chiu Wang, Chi Chiu Decreased MUC1 in endometrium is an independent receptivity marker in recurrent implantation failure during implantation window |
title | Decreased MUC1 in endometrium is an independent receptivity marker in recurrent implantation failure during implantation window |
title_full | Decreased MUC1 in endometrium is an independent receptivity marker in recurrent implantation failure during implantation window |
title_fullStr | Decreased MUC1 in endometrium is an independent receptivity marker in recurrent implantation failure during implantation window |
title_full_unstemmed | Decreased MUC1 in endometrium is an independent receptivity marker in recurrent implantation failure during implantation window |
title_short | Decreased MUC1 in endometrium is an independent receptivity marker in recurrent implantation failure during implantation window |
title_sort | decreased muc1 in endometrium is an independent receptivity marker in recurrent implantation failure during implantation window |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6013892/ https://www.ncbi.nlm.nih.gov/pubmed/29929546 http://dx.doi.org/10.1186/s12958-018-0379-1 |
work_keys_str_mv | AT wufangrong decreasedmuc1inendometriumisanindependentreceptivitymarkerinrecurrentimplantationfailureduringimplantationwindow AT chenxiaoyan decreasedmuc1inendometriumisanindependentreceptivitymarkerinrecurrentimplantationfailureduringimplantationwindow AT liuyingyu decreasedmuc1inendometriumisanindependentreceptivitymarkerinrecurrentimplantationfailureduringimplantationwindow AT liangbo decreasedmuc1inendometriumisanindependentreceptivitymarkerinrecurrentimplantationfailureduringimplantationwindow AT xuhui decreasedmuc1inendometriumisanindependentreceptivitymarkerinrecurrentimplantationfailureduringimplantationwindow AT litinchiu decreasedmuc1inendometriumisanindependentreceptivitymarkerinrecurrentimplantationfailureduringimplantationwindow AT wangchichiu decreasedmuc1inendometriumisanindependentreceptivitymarkerinrecurrentimplantationfailureduringimplantationwindow |