Cargando…
Social and physical environmental correlates of independent mobility in children: a systematic review taking sex/gender differences into account
BACKGROUND: Children’s independent mobility (CIM) is an important contributor to physical activity and health in children. However, in the last 20 years CIM has significantly decreased. To develop effective intervention programs to promote CIM, the impact of the environment on CIM must be identified...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6029402/ https://www.ncbi.nlm.nih.gov/pubmed/29970117 http://dx.doi.org/10.1186/s12942-018-0145-9 |
_version_ | 1783336955003535360 |
---|---|
author | Marzi, Isabel Demetriou, Yolanda Reimers, Anne Kerstin |
author_facet | Marzi, Isabel Demetriou, Yolanda Reimers, Anne Kerstin |
author_sort | Marzi, Isabel |
collection | PubMed |
description | BACKGROUND: Children’s independent mobility (CIM) is an important contributor to physical activity and health in children. However, in the last 20 years CIM has significantly decreased. To develop effective intervention programs to promote CIM, the impact of the environment on CIM must be identified. This review seeks to provide an overview of sex/gender-specific socio-ecological correlates of CIM. METHODS: A systematic literature search of five databases (PubMed, PsycInfo, Scopus, Medline, Web of Science) was conducted with a priori defined eligibility criteria and identified 1838 potential articles published between January 1990 and November 2017. Two independent reviewers screened the literature and identified and rated methodological quality of the studies. Related factors of CIM were summarized separately for CIM license (parental permission to travel independently) and CIM destination (destinations to which a child travels independently), and separately for boys and girls using a semi-quantitative method. RESULTS: Twenty-seven peer-reviewed journal articles were identified which examined the relationship between the social and physical environment and CIM. Only seven studies reported results divided by sex/gender. Most associations between the environment and CIM were found in the expected direction (positive or negative) or not associated at all. The social environment seemed to be more influential for ensuring CIM than the physical environment. Neighborhood safety, fear of crime and stranger, parental support, and perception of traffic were important social environmental factors influencing CIM, while car ownership, distance, and neighborhood design were relevant physical environmental attributes. Few studies examined sex/gender-related environmental correlates of independent mobility, and those findings were inconsistent. CONCLUSION: The findings of this systematic review serve as suggestions for intervention programs to increase CIM and to identify future directions in research. To establish a robust comprehension of the impact of the social and physical environment on CIM, further sex/gender-sensitive studies using comparable measurements for CIM and environmental correlates are needed. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12942-018-0145-9) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6029402 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-60294022018-07-09 Social and physical environmental correlates of independent mobility in children: a systematic review taking sex/gender differences into account Marzi, Isabel Demetriou, Yolanda Reimers, Anne Kerstin Int J Health Geogr Review BACKGROUND: Children’s independent mobility (CIM) is an important contributor to physical activity and health in children. However, in the last 20 years CIM has significantly decreased. To develop effective intervention programs to promote CIM, the impact of the environment on CIM must be identified. This review seeks to provide an overview of sex/gender-specific socio-ecological correlates of CIM. METHODS: A systematic literature search of five databases (PubMed, PsycInfo, Scopus, Medline, Web of Science) was conducted with a priori defined eligibility criteria and identified 1838 potential articles published between January 1990 and November 2017. Two independent reviewers screened the literature and identified and rated methodological quality of the studies. Related factors of CIM were summarized separately for CIM license (parental permission to travel independently) and CIM destination (destinations to which a child travels independently), and separately for boys and girls using a semi-quantitative method. RESULTS: Twenty-seven peer-reviewed journal articles were identified which examined the relationship between the social and physical environment and CIM. Only seven studies reported results divided by sex/gender. Most associations between the environment and CIM were found in the expected direction (positive or negative) or not associated at all. The social environment seemed to be more influential for ensuring CIM than the physical environment. Neighborhood safety, fear of crime and stranger, parental support, and perception of traffic were important social environmental factors influencing CIM, while car ownership, distance, and neighborhood design were relevant physical environmental attributes. Few studies examined sex/gender-related environmental correlates of independent mobility, and those findings were inconsistent. CONCLUSION: The findings of this systematic review serve as suggestions for intervention programs to increase CIM and to identify future directions in research. To establish a robust comprehension of the impact of the social and physical environment on CIM, further sex/gender-sensitive studies using comparable measurements for CIM and environmental correlates are needed. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12942-018-0145-9) contains supplementary material, which is available to authorized users. BioMed Central 2018-07-03 /pmc/articles/PMC6029402/ /pubmed/29970117 http://dx.doi.org/10.1186/s12942-018-0145-9 Text en © The Author(s) 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Review Marzi, Isabel Demetriou, Yolanda Reimers, Anne Kerstin Social and physical environmental correlates of independent mobility in children: a systematic review taking sex/gender differences into account |
title | Social and physical environmental correlates of independent mobility in children: a systematic review taking sex/gender differences into account |
title_full | Social and physical environmental correlates of independent mobility in children: a systematic review taking sex/gender differences into account |
title_fullStr | Social and physical environmental correlates of independent mobility in children: a systematic review taking sex/gender differences into account |
title_full_unstemmed | Social and physical environmental correlates of independent mobility in children: a systematic review taking sex/gender differences into account |
title_short | Social and physical environmental correlates of independent mobility in children: a systematic review taking sex/gender differences into account |
title_sort | social and physical environmental correlates of independent mobility in children: a systematic review taking sex/gender differences into account |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6029402/ https://www.ncbi.nlm.nih.gov/pubmed/29970117 http://dx.doi.org/10.1186/s12942-018-0145-9 |
work_keys_str_mv | AT marziisabel socialandphysicalenvironmentalcorrelatesofindependentmobilityinchildrenasystematicreviewtakingsexgenderdifferencesintoaccount AT demetriouyolanda socialandphysicalenvironmentalcorrelatesofindependentmobilityinchildrenasystematicreviewtakingsexgenderdifferencesintoaccount AT reimersannekerstin socialandphysicalenvironmentalcorrelatesofindependentmobilityinchildrenasystematicreviewtakingsexgenderdifferencesintoaccount |