Cargando…
Modulation of Spike-Timing Dependent Plasticity: Towards the Inclusion of a Third Factor in Computational Models
In spike-timing dependent plasticity (STDP) change in synaptic strength depends on the timing of pre- vs. postsynaptic spiking activity. Since STDP is in compliance with Hebb’s postulate, it is considered one of the major mechanisms of memory storage and recall. STDP comprises a system of two coinci...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6037788/ https://www.ncbi.nlm.nih.gov/pubmed/30018546 http://dx.doi.org/10.3389/fncom.2018.00049 |
_version_ | 1783338383971450880 |
---|---|
author | Foncelle, Alexandre Mendes, Alexandre Jędrzejewska-Szmek, Joanna Valtcheva, Silvana Berry, Hugues Blackwell, Kim T. Venance, Laurent |
author_facet | Foncelle, Alexandre Mendes, Alexandre Jędrzejewska-Szmek, Joanna Valtcheva, Silvana Berry, Hugues Blackwell, Kim T. Venance, Laurent |
author_sort | Foncelle, Alexandre |
collection | PubMed |
description | In spike-timing dependent plasticity (STDP) change in synaptic strength depends on the timing of pre- vs. postsynaptic spiking activity. Since STDP is in compliance with Hebb’s postulate, it is considered one of the major mechanisms of memory storage and recall. STDP comprises a system of two coincidence detectors with N-methyl-D-aspartate receptor (NMDAR) activation often posited as one of the main components. Numerous studies have unveiled a third component of this coincidence detection system, namely neuromodulation and glia activity shaping STDP. Even though dopaminergic control of STDP has most often been reported, acetylcholine, noradrenaline, nitric oxide (NO), brain-derived neurotrophic factor (BDNF) or gamma-aminobutyric acid (GABA) also has been shown to effectively modulate STDP. Furthermore, it has been demonstrated that astrocytes, via the release or uptake of glutamate, gate STDP expression. At the most fundamental level, the timing properties of STDP are expected to depend on the spatiotemporal dynamics of the underlying signaling pathways. However in most cases, due to technical limitations experiments grant only indirect access to these pathways. Computational models carefully constrained by experiments, allow for a better qualitative understanding of the molecular basis of STDP and its regulation by neuromodulators. Recently, computational models of calcium dynamics and signaling pathway molecules have started to explore STDP emergence in ex and in vivo-like conditions. These models are expected to reproduce better at least part of the complex modulation of STDP as an emergent property of the underlying molecular pathways. Elucidation of the mechanisms underlying STDP modulation and its consequences on network dynamics is of critical importance and will allow better understanding of the major mechanisms of memory storage and recall both in health and disease. |
format | Online Article Text |
id | pubmed-6037788 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-60377882018-07-17 Modulation of Spike-Timing Dependent Plasticity: Towards the Inclusion of a Third Factor in Computational Models Foncelle, Alexandre Mendes, Alexandre Jędrzejewska-Szmek, Joanna Valtcheva, Silvana Berry, Hugues Blackwell, Kim T. Venance, Laurent Front Comput Neurosci Neuroscience In spike-timing dependent plasticity (STDP) change in synaptic strength depends on the timing of pre- vs. postsynaptic spiking activity. Since STDP is in compliance with Hebb’s postulate, it is considered one of the major mechanisms of memory storage and recall. STDP comprises a system of two coincidence detectors with N-methyl-D-aspartate receptor (NMDAR) activation often posited as one of the main components. Numerous studies have unveiled a third component of this coincidence detection system, namely neuromodulation and glia activity shaping STDP. Even though dopaminergic control of STDP has most often been reported, acetylcholine, noradrenaline, nitric oxide (NO), brain-derived neurotrophic factor (BDNF) or gamma-aminobutyric acid (GABA) also has been shown to effectively modulate STDP. Furthermore, it has been demonstrated that astrocytes, via the release or uptake of glutamate, gate STDP expression. At the most fundamental level, the timing properties of STDP are expected to depend on the spatiotemporal dynamics of the underlying signaling pathways. However in most cases, due to technical limitations experiments grant only indirect access to these pathways. Computational models carefully constrained by experiments, allow for a better qualitative understanding of the molecular basis of STDP and its regulation by neuromodulators. Recently, computational models of calcium dynamics and signaling pathway molecules have started to explore STDP emergence in ex and in vivo-like conditions. These models are expected to reproduce better at least part of the complex modulation of STDP as an emergent property of the underlying molecular pathways. Elucidation of the mechanisms underlying STDP modulation and its consequences on network dynamics is of critical importance and will allow better understanding of the major mechanisms of memory storage and recall both in health and disease. Frontiers Media S.A. 2018-07-03 /pmc/articles/PMC6037788/ /pubmed/30018546 http://dx.doi.org/10.3389/fncom.2018.00049 Text en Copyright © 2018 Foncelle, Mendes, Jędrzejewska-Szmek, Valtcheva, Berry, Blackwell and Venance. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Neuroscience Foncelle, Alexandre Mendes, Alexandre Jędrzejewska-Szmek, Joanna Valtcheva, Silvana Berry, Hugues Blackwell, Kim T. Venance, Laurent Modulation of Spike-Timing Dependent Plasticity: Towards the Inclusion of a Third Factor in Computational Models |
title | Modulation of Spike-Timing Dependent Plasticity: Towards the Inclusion of a Third Factor in Computational Models |
title_full | Modulation of Spike-Timing Dependent Plasticity: Towards the Inclusion of a Third Factor in Computational Models |
title_fullStr | Modulation of Spike-Timing Dependent Plasticity: Towards the Inclusion of a Third Factor in Computational Models |
title_full_unstemmed | Modulation of Spike-Timing Dependent Plasticity: Towards the Inclusion of a Third Factor in Computational Models |
title_short | Modulation of Spike-Timing Dependent Plasticity: Towards the Inclusion of a Third Factor in Computational Models |
title_sort | modulation of spike-timing dependent plasticity: towards the inclusion of a third factor in computational models |
topic | Neuroscience |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6037788/ https://www.ncbi.nlm.nih.gov/pubmed/30018546 http://dx.doi.org/10.3389/fncom.2018.00049 |
work_keys_str_mv | AT foncellealexandre modulationofspiketimingdependentplasticitytowardstheinclusionofathirdfactorincomputationalmodels AT mendesalexandre modulationofspiketimingdependentplasticitytowardstheinclusionofathirdfactorincomputationalmodels AT jedrzejewskaszmekjoanna modulationofspiketimingdependentplasticitytowardstheinclusionofathirdfactorincomputationalmodels AT valtchevasilvana modulationofspiketimingdependentplasticitytowardstheinclusionofathirdfactorincomputationalmodels AT berryhugues modulationofspiketimingdependentplasticitytowardstheinclusionofathirdfactorincomputationalmodels AT blackwellkimt modulationofspiketimingdependentplasticitytowardstheinclusionofathirdfactorincomputationalmodels AT venancelaurent modulationofspiketimingdependentplasticitytowardstheinclusionofathirdfactorincomputationalmodels |