Cargando…
Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2
The role of KRAS, when activated through canonical mutations, has been well established in cancer(1). Here we explore a secondary means of KRAS activation in cancer, focal high-level amplification of the KRAS gene in the absence of coding mutations. These amplifications occur most commonly in esopha...
Autores principales: | , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6039276/ https://www.ncbi.nlm.nih.gov/pubmed/29808010 http://dx.doi.org/10.1038/s41591-018-0022-x |
_version_ | 1783338644230111232 |
---|---|
author | Wong, Gabrielle S. Zhou, Jin Liu, Jie Bin Wu, Zhong Xu, Xinsen Li, Tianxia Xu, David Schumacher, Steven E. Puschhof, Jens McFarland, James Zou, Charles Dulak, Austin Henderson, Les Xu, Peng O’Day, Emily Rendak, Rachel Liao, Wei-li Cecchi, Fabiola Hembrough, Todd Schwartz, Sarit Szeto, Christopher Rustgi, Anil K. Wong, Kwok-Kin Diehl, J. Alan Jensen, Karin Graziano, Francesco Ruzzo, Annamaria Fereshetian, Shaunt Mertins, Philipp Carr, Steven A. Beroukhim, Rameen Nakamura, Kenichi Oki, Eiji Watanabe, Masayuki Baba, Hideo Imamura, Yu Catenacci, Daniel Bass, Adam J. |
author_facet | Wong, Gabrielle S. Zhou, Jin Liu, Jie Bin Wu, Zhong Xu, Xinsen Li, Tianxia Xu, David Schumacher, Steven E. Puschhof, Jens McFarland, James Zou, Charles Dulak, Austin Henderson, Les Xu, Peng O’Day, Emily Rendak, Rachel Liao, Wei-li Cecchi, Fabiola Hembrough, Todd Schwartz, Sarit Szeto, Christopher Rustgi, Anil K. Wong, Kwok-Kin Diehl, J. Alan Jensen, Karin Graziano, Francesco Ruzzo, Annamaria Fereshetian, Shaunt Mertins, Philipp Carr, Steven A. Beroukhim, Rameen Nakamura, Kenichi Oki, Eiji Watanabe, Masayuki Baba, Hideo Imamura, Yu Catenacci, Daniel Bass, Adam J. |
author_sort | Wong, Gabrielle S. |
collection | PubMed |
description | The role of KRAS, when activated through canonical mutations, has been well established in cancer(1). Here we explore a secondary means of KRAS activation in cancer, focal high-level amplification of the KRAS gene in the absence of coding mutations. These amplifications occur most commonly in esophageal, gastric and ovarian adenocarcinomas(2–4). KRAS amplified gastric cancer models possess marked overexpression of KRAS protein and are insensitive to MAPK blockade due to their capacity to adaptively respond by rapidly increasing KRAS-GTP levels. We demonstrate that inhibition of guanine exchange factors SOS1/2 or protein tyrosine phosphatase, SHP2, can attenuate this adaptive process and that targeting of these factors, both genetically and pharmacologically, can enhance sensitivity of KRAS-amplified models to MEK inhibition both in in vitro and in vivo settings. These data demonstrate the relevance of copy number amplification as a mechanism of KRAS activation, and uncover the therapeutic potential for targeting of these tumors through combined SHP2 and MEK inhibition. |
format | Online Article Text |
id | pubmed-6039276 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
record_format | MEDLINE/PubMed |
spelling | pubmed-60392762018-11-28 Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2 Wong, Gabrielle S. Zhou, Jin Liu, Jie Bin Wu, Zhong Xu, Xinsen Li, Tianxia Xu, David Schumacher, Steven E. Puschhof, Jens McFarland, James Zou, Charles Dulak, Austin Henderson, Les Xu, Peng O’Day, Emily Rendak, Rachel Liao, Wei-li Cecchi, Fabiola Hembrough, Todd Schwartz, Sarit Szeto, Christopher Rustgi, Anil K. Wong, Kwok-Kin Diehl, J. Alan Jensen, Karin Graziano, Francesco Ruzzo, Annamaria Fereshetian, Shaunt Mertins, Philipp Carr, Steven A. Beroukhim, Rameen Nakamura, Kenichi Oki, Eiji Watanabe, Masayuki Baba, Hideo Imamura, Yu Catenacci, Daniel Bass, Adam J. Nat Med Article The role of KRAS, when activated through canonical mutations, has been well established in cancer(1). Here we explore a secondary means of KRAS activation in cancer, focal high-level amplification of the KRAS gene in the absence of coding mutations. These amplifications occur most commonly in esophageal, gastric and ovarian adenocarcinomas(2–4). KRAS amplified gastric cancer models possess marked overexpression of KRAS protein and are insensitive to MAPK blockade due to their capacity to adaptively respond by rapidly increasing KRAS-GTP levels. We demonstrate that inhibition of guanine exchange factors SOS1/2 or protein tyrosine phosphatase, SHP2, can attenuate this adaptive process and that targeting of these factors, both genetically and pharmacologically, can enhance sensitivity of KRAS-amplified models to MEK inhibition both in in vitro and in vivo settings. These data demonstrate the relevance of copy number amplification as a mechanism of KRAS activation, and uncover the therapeutic potential for targeting of these tumors through combined SHP2 and MEK inhibition. 2018-05-28 2018-07 /pmc/articles/PMC6039276/ /pubmed/29808010 http://dx.doi.org/10.1038/s41591-018-0022-x Text en Users may view, print, copy, and download text and data-mine the content in such documents, for the purposes of academic research, subject always to the full Conditions of use: http://www.nature.com/authors/editorial_policies/license.html#terms |
spellingShingle | Article Wong, Gabrielle S. Zhou, Jin Liu, Jie Bin Wu, Zhong Xu, Xinsen Li, Tianxia Xu, David Schumacher, Steven E. Puschhof, Jens McFarland, James Zou, Charles Dulak, Austin Henderson, Les Xu, Peng O’Day, Emily Rendak, Rachel Liao, Wei-li Cecchi, Fabiola Hembrough, Todd Schwartz, Sarit Szeto, Christopher Rustgi, Anil K. Wong, Kwok-Kin Diehl, J. Alan Jensen, Karin Graziano, Francesco Ruzzo, Annamaria Fereshetian, Shaunt Mertins, Philipp Carr, Steven A. Beroukhim, Rameen Nakamura, Kenichi Oki, Eiji Watanabe, Masayuki Baba, Hideo Imamura, Yu Catenacci, Daniel Bass, Adam J. Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2 |
title | Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2 |
title_full | Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2 |
title_fullStr | Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2 |
title_full_unstemmed | Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2 |
title_short | Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2 |
title_sort | targeting wild-type kras amplified gastroesophageal cancer through combined mek and shp2 |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6039276/ https://www.ncbi.nlm.nih.gov/pubmed/29808010 http://dx.doi.org/10.1038/s41591-018-0022-x |
work_keys_str_mv | AT wonggabrielles targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT zhoujin targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT liujiebin targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT wuzhong targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT xuxinsen targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT litianxia targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT xudavid targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT schumacherstevene targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT puschhofjens targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT mcfarlandjames targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT zoucharles targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT dulakaustin targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT hendersonles targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT xupeng targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT odayemily targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT rendakrachel targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT liaoweili targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT cecchifabiola targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT hembroughtodd targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT schwartzsarit targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT szetochristopher targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT rustgianilk targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT wongkwokkin targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT diehljalan targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT jensenkarin targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT grazianofrancesco targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT ruzzoannamaria targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT fereshetianshaunt targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT mertinsphilipp targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT carrstevena targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT beroukhimrameen targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT nakamurakenichi targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT okieiji targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT watanabemasayuki targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT babahideo targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT imamurayu targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT catenaccidaniel targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 AT bassadamj targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2 |