Cargando…

Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2

The role of KRAS, when activated through canonical mutations, has been well established in cancer(1). Here we explore a secondary means of KRAS activation in cancer, focal high-level amplification of the KRAS gene in the absence of coding mutations. These amplifications occur most commonly in esopha...

Descripción completa

Detalles Bibliográficos
Autores principales: Wong, Gabrielle S., Zhou, Jin, Liu, Jie Bin, Wu, Zhong, Xu, Xinsen, Li, Tianxia, Xu, David, Schumacher, Steven E., Puschhof, Jens, McFarland, James, Zou, Charles, Dulak, Austin, Henderson, Les, Xu, Peng, O’Day, Emily, Rendak, Rachel, Liao, Wei-li, Cecchi, Fabiola, Hembrough, Todd, Schwartz, Sarit, Szeto, Christopher, Rustgi, Anil K., Wong, Kwok-Kin, Diehl, J. Alan, Jensen, Karin, Graziano, Francesco, Ruzzo, Annamaria, Fereshetian, Shaunt, Mertins, Philipp, Carr, Steven A., Beroukhim, Rameen, Nakamura, Kenichi, Oki, Eiji, Watanabe, Masayuki, Baba, Hideo, Imamura, Yu, Catenacci, Daniel, Bass, Adam J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6039276/
https://www.ncbi.nlm.nih.gov/pubmed/29808010
http://dx.doi.org/10.1038/s41591-018-0022-x
_version_ 1783338644230111232
author Wong, Gabrielle S.
Zhou, Jin
Liu, Jie Bin
Wu, Zhong
Xu, Xinsen
Li, Tianxia
Xu, David
Schumacher, Steven E.
Puschhof, Jens
McFarland, James
Zou, Charles
Dulak, Austin
Henderson, Les
Xu, Peng
O’Day, Emily
Rendak, Rachel
Liao, Wei-li
Cecchi, Fabiola
Hembrough, Todd
Schwartz, Sarit
Szeto, Christopher
Rustgi, Anil K.
Wong, Kwok-Kin
Diehl, J. Alan
Jensen, Karin
Graziano, Francesco
Ruzzo, Annamaria
Fereshetian, Shaunt
Mertins, Philipp
Carr, Steven A.
Beroukhim, Rameen
Nakamura, Kenichi
Oki, Eiji
Watanabe, Masayuki
Baba, Hideo
Imamura, Yu
Catenacci, Daniel
Bass, Adam J.
author_facet Wong, Gabrielle S.
Zhou, Jin
Liu, Jie Bin
Wu, Zhong
Xu, Xinsen
Li, Tianxia
Xu, David
Schumacher, Steven E.
Puschhof, Jens
McFarland, James
Zou, Charles
Dulak, Austin
Henderson, Les
Xu, Peng
O’Day, Emily
Rendak, Rachel
Liao, Wei-li
Cecchi, Fabiola
Hembrough, Todd
Schwartz, Sarit
Szeto, Christopher
Rustgi, Anil K.
Wong, Kwok-Kin
Diehl, J. Alan
Jensen, Karin
Graziano, Francesco
Ruzzo, Annamaria
Fereshetian, Shaunt
Mertins, Philipp
Carr, Steven A.
Beroukhim, Rameen
Nakamura, Kenichi
Oki, Eiji
Watanabe, Masayuki
Baba, Hideo
Imamura, Yu
Catenacci, Daniel
Bass, Adam J.
author_sort Wong, Gabrielle S.
collection PubMed
description The role of KRAS, when activated through canonical mutations, has been well established in cancer(1). Here we explore a secondary means of KRAS activation in cancer, focal high-level amplification of the KRAS gene in the absence of coding mutations. These amplifications occur most commonly in esophageal, gastric and ovarian adenocarcinomas(2–4). KRAS amplified gastric cancer models possess marked overexpression of KRAS protein and are insensitive to MAPK blockade due to their capacity to adaptively respond by rapidly increasing KRAS-GTP levels. We demonstrate that inhibition of guanine exchange factors SOS1/2 or protein tyrosine phosphatase, SHP2, can attenuate this adaptive process and that targeting of these factors, both genetically and pharmacologically, can enhance sensitivity of KRAS-amplified models to MEK inhibition both in in vitro and in vivo settings. These data demonstrate the relevance of copy number amplification as a mechanism of KRAS activation, and uncover the therapeutic potential for targeting of these tumors through combined SHP2 and MEK inhibition.
format Online
Article
Text
id pubmed-6039276
institution National Center for Biotechnology Information
language English
publishDate 2018
record_format MEDLINE/PubMed
spelling pubmed-60392762018-11-28 Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2 Wong, Gabrielle S. Zhou, Jin Liu, Jie Bin Wu, Zhong Xu, Xinsen Li, Tianxia Xu, David Schumacher, Steven E. Puschhof, Jens McFarland, James Zou, Charles Dulak, Austin Henderson, Les Xu, Peng O’Day, Emily Rendak, Rachel Liao, Wei-li Cecchi, Fabiola Hembrough, Todd Schwartz, Sarit Szeto, Christopher Rustgi, Anil K. Wong, Kwok-Kin Diehl, J. Alan Jensen, Karin Graziano, Francesco Ruzzo, Annamaria Fereshetian, Shaunt Mertins, Philipp Carr, Steven A. Beroukhim, Rameen Nakamura, Kenichi Oki, Eiji Watanabe, Masayuki Baba, Hideo Imamura, Yu Catenacci, Daniel Bass, Adam J. Nat Med Article The role of KRAS, when activated through canonical mutations, has been well established in cancer(1). Here we explore a secondary means of KRAS activation in cancer, focal high-level amplification of the KRAS gene in the absence of coding mutations. These amplifications occur most commonly in esophageal, gastric and ovarian adenocarcinomas(2–4). KRAS amplified gastric cancer models possess marked overexpression of KRAS protein and are insensitive to MAPK blockade due to their capacity to adaptively respond by rapidly increasing KRAS-GTP levels. We demonstrate that inhibition of guanine exchange factors SOS1/2 or protein tyrosine phosphatase, SHP2, can attenuate this adaptive process and that targeting of these factors, both genetically and pharmacologically, can enhance sensitivity of KRAS-amplified models to MEK inhibition both in in vitro and in vivo settings. These data demonstrate the relevance of copy number amplification as a mechanism of KRAS activation, and uncover the therapeutic potential for targeting of these tumors through combined SHP2 and MEK inhibition. 2018-05-28 2018-07 /pmc/articles/PMC6039276/ /pubmed/29808010 http://dx.doi.org/10.1038/s41591-018-0022-x Text en Users may view, print, copy, and download text and data-mine the content in such documents, for the purposes of academic research, subject always to the full Conditions of use: http://www.nature.com/authors/editorial_policies/license.html#terms
spellingShingle Article
Wong, Gabrielle S.
Zhou, Jin
Liu, Jie Bin
Wu, Zhong
Xu, Xinsen
Li, Tianxia
Xu, David
Schumacher, Steven E.
Puschhof, Jens
McFarland, James
Zou, Charles
Dulak, Austin
Henderson, Les
Xu, Peng
O’Day, Emily
Rendak, Rachel
Liao, Wei-li
Cecchi, Fabiola
Hembrough, Todd
Schwartz, Sarit
Szeto, Christopher
Rustgi, Anil K.
Wong, Kwok-Kin
Diehl, J. Alan
Jensen, Karin
Graziano, Francesco
Ruzzo, Annamaria
Fereshetian, Shaunt
Mertins, Philipp
Carr, Steven A.
Beroukhim, Rameen
Nakamura, Kenichi
Oki, Eiji
Watanabe, Masayuki
Baba, Hideo
Imamura, Yu
Catenacci, Daniel
Bass, Adam J.
Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2
title Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2
title_full Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2
title_fullStr Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2
title_full_unstemmed Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2
title_short Targeting wild-type KRAS amplified gastroesophageal cancer through combined MEK and SHP2
title_sort targeting wild-type kras amplified gastroesophageal cancer through combined mek and shp2
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6039276/
https://www.ncbi.nlm.nih.gov/pubmed/29808010
http://dx.doi.org/10.1038/s41591-018-0022-x
work_keys_str_mv AT wonggabrielles targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT zhoujin targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT liujiebin targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT wuzhong targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT xuxinsen targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT litianxia targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT xudavid targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT schumacherstevene targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT puschhofjens targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT mcfarlandjames targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT zoucharles targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT dulakaustin targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT hendersonles targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT xupeng targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT odayemily targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT rendakrachel targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT liaoweili targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT cecchifabiola targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT hembroughtodd targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT schwartzsarit targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT szetochristopher targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT rustgianilk targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT wongkwokkin targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT diehljalan targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT jensenkarin targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT grazianofrancesco targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT ruzzoannamaria targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT fereshetianshaunt targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT mertinsphilipp targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT carrstevena targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT beroukhimrameen targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT nakamurakenichi targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT okieiji targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT watanabemasayuki targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT babahideo targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT imamurayu targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT catenaccidaniel targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2
AT bassadamj targetingwildtypekrasamplifiedgastroesophagealcancerthroughcombinedmekandshp2