Cargando…
An assessment of a pediatric early warning system score in severe hand-foot-and-mouth disease children: To detect clinical deterioration in hospitalized children
Identification of deteriorating severe hand, foot, and mouth disease (HFMD) children for referral to intensive care remains problematic. The medical records of 2382 hospitalized children with severe HFMD from May 2013 to September 2015 were retrospectively reviewed. A Pediatric Early Warning System...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Wolters Kluwer Health
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6039599/ https://www.ncbi.nlm.nih.gov/pubmed/29953028 http://dx.doi.org/10.1097/MD.0000000000011355 |
_version_ | 1783338707489652736 |
---|---|
author | Mei, Lu Song, Xin Kong, Yan Yu, Guiling |
author_facet | Mei, Lu Song, Xin Kong, Yan Yu, Guiling |
author_sort | Mei, Lu |
collection | PubMed |
description | Identification of deteriorating severe hand, foot, and mouth disease (HFMD) children for referral to intensive care remains problematic. The medical records of 2382 hospitalized children with severe HFMD from May 2013 to September 2015 were retrospectively reviewed. A Pediatric Early Warning System (PEWS) score was designed based on study parameters on admission, evaluated in a logistic regression model, and subsequently validated with different cut-off scores, to predict the risk for clinical deterioration. After admission, 191 cases were transferred to the pediatric intensive care unit (PICU) and 2191 were admitted to the infectious disease department. Of which, 116 cases were subsequently transferred to PICU, with younger age, consciousness levels of sluggishness, lethargy or drowsiness, rashes with vesicles on the hands or feet, moderate or high fever, increased or disordered lung marking or pulmonary infiltration, abnormal heart rate, fasting plasma glucose, blood platelet, and C-reactive protein. A corresponding 10-component PEWS score >7 was significantly associated with subsequent transfer to PICU. A 10-component PEWS score >7 has good specificity but poor sensitivity for identifying severe HFMD children vulnerable to clinical deterioration. |
format | Online Article Text |
id | pubmed-6039599 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Wolters Kluwer Health |
record_format | MEDLINE/PubMed |
spelling | pubmed-60395992018-07-16 An assessment of a pediatric early warning system score in severe hand-foot-and-mouth disease children: To detect clinical deterioration in hospitalized children Mei, Lu Song, Xin Kong, Yan Yu, Guiling Medicine (Baltimore) Research Article Identification of deteriorating severe hand, foot, and mouth disease (HFMD) children for referral to intensive care remains problematic. The medical records of 2382 hospitalized children with severe HFMD from May 2013 to September 2015 were retrospectively reviewed. A Pediatric Early Warning System (PEWS) score was designed based on study parameters on admission, evaluated in a logistic regression model, and subsequently validated with different cut-off scores, to predict the risk for clinical deterioration. After admission, 191 cases were transferred to the pediatric intensive care unit (PICU) and 2191 were admitted to the infectious disease department. Of which, 116 cases were subsequently transferred to PICU, with younger age, consciousness levels of sluggishness, lethargy or drowsiness, rashes with vesicles on the hands or feet, moderate or high fever, increased or disordered lung marking or pulmonary infiltration, abnormal heart rate, fasting plasma glucose, blood platelet, and C-reactive protein. A corresponding 10-component PEWS score >7 was significantly associated with subsequent transfer to PICU. A 10-component PEWS score >7 has good specificity but poor sensitivity for identifying severe HFMD children vulnerable to clinical deterioration. Wolters Kluwer Health 2018-06-29 /pmc/articles/PMC6039599/ /pubmed/29953028 http://dx.doi.org/10.1097/MD.0000000000011355 Text en Copyright © 2018 the Author(s). Published by Wolters Kluwer Health, Inc. http://creativecommons.org/licenses/by/4.0 This is an open access article distributed under the Creative Commons Attribution License 4.0 (CCBY), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. http://creativecommons.org/licenses/by/4.0 |
spellingShingle | Research Article Mei, Lu Song, Xin Kong, Yan Yu, Guiling An assessment of a pediatric early warning system score in severe hand-foot-and-mouth disease children: To detect clinical deterioration in hospitalized children |
title | An assessment of a pediatric early warning system score in severe hand-foot-and-mouth disease children: To detect clinical deterioration in hospitalized children |
title_full | An assessment of a pediatric early warning system score in severe hand-foot-and-mouth disease children: To detect clinical deterioration in hospitalized children |
title_fullStr | An assessment of a pediatric early warning system score in severe hand-foot-and-mouth disease children: To detect clinical deterioration in hospitalized children |
title_full_unstemmed | An assessment of a pediatric early warning system score in severe hand-foot-and-mouth disease children: To detect clinical deterioration in hospitalized children |
title_short | An assessment of a pediatric early warning system score in severe hand-foot-and-mouth disease children: To detect clinical deterioration in hospitalized children |
title_sort | assessment of a pediatric early warning system score in severe hand-foot-and-mouth disease children: to detect clinical deterioration in hospitalized children |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6039599/ https://www.ncbi.nlm.nih.gov/pubmed/29953028 http://dx.doi.org/10.1097/MD.0000000000011355 |
work_keys_str_mv | AT meilu anassessmentofapediatricearlywarningsystemscoreinseverehandfootandmouthdiseasechildrentodetectclinicaldeteriorationinhospitalizedchildren AT songxin anassessmentofapediatricearlywarningsystemscoreinseverehandfootandmouthdiseasechildrentodetectclinicaldeteriorationinhospitalizedchildren AT kongyan anassessmentofapediatricearlywarningsystemscoreinseverehandfootandmouthdiseasechildrentodetectclinicaldeteriorationinhospitalizedchildren AT yuguiling anassessmentofapediatricearlywarningsystemscoreinseverehandfootandmouthdiseasechildrentodetectclinicaldeteriorationinhospitalizedchildren AT meilu assessmentofapediatricearlywarningsystemscoreinseverehandfootandmouthdiseasechildrentodetectclinicaldeteriorationinhospitalizedchildren AT songxin assessmentofapediatricearlywarningsystemscoreinseverehandfootandmouthdiseasechildrentodetectclinicaldeteriorationinhospitalizedchildren AT kongyan assessmentofapediatricearlywarningsystemscoreinseverehandfootandmouthdiseasechildrentodetectclinicaldeteriorationinhospitalizedchildren AT yuguiling assessmentofapediatricearlywarningsystemscoreinseverehandfootandmouthdiseasechildrentodetectclinicaldeteriorationinhospitalizedchildren |