Cargando…
Correction to: Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study
| Autores principales: | , , , , , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2018
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6043976/ https://www.ncbi.nlm.nih.gov/pubmed/30001193 http://dx.doi.org/10.1186/s12889-018-5775-0 |
| _version_ | 1783339389672226816 |
|---|---|
| author | Dodds, C. Mugweni, E. Phillips, G. Park, C. Young, I. Fakoya, I. Wayal, S. McDaid, L. Sachikonye, M. Chwaula, J. Flowers, P. Burns, F. |
| author_facet | Dodds, C. Mugweni, E. Phillips, G. Park, C. Young, I. Fakoya, I. Wayal, S. McDaid, L. Sachikonye, M. Chwaula, J. Flowers, P. Burns, F. |
| author_sort | Dodds, C. |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-6043976 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2018 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-60439762018-07-13 Correction to: Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study Dodds, C. Mugweni, E. Phillips, G. Park, C. Young, I. Fakoya, I. Wayal, S. McDaid, L. Sachikonye, M. Chwaula, J. Flowers, P. Burns, F. BMC Public Health Correction BioMed Central 2018-07-12 /pmc/articles/PMC6043976/ /pubmed/30001193 http://dx.doi.org/10.1186/s12889-018-5775-0 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Correction Dodds, C. Mugweni, E. Phillips, G. Park, C. Young, I. Fakoya, I. Wayal, S. McDaid, L. Sachikonye, M. Chwaula, J. Flowers, P. Burns, F. Correction to: Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study |
| title | Correction to: Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study |
| title_full | Correction to: Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study |
| title_fullStr | Correction to: Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study |
| title_full_unstemmed | Correction to: Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study |
| title_short | Correction to: Acceptability of HIV self-sampling kits (TINY vial) among people of black African ethnicity in the UK: a qualitative study |
| title_sort | correction to: acceptability of hiv self-sampling kits (tiny vial) among people of black african ethnicity in the uk: a qualitative study |
| topic | Correction |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6043976/ https://www.ncbi.nlm.nih.gov/pubmed/30001193 http://dx.doi.org/10.1186/s12889-018-5775-0 |
| work_keys_str_mv | AT doddsc correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy AT mugwenie correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy AT phillipsg correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy AT parkc correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy AT youngi correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy AT fakoyai correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy AT wayals correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy AT mcdaidl correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy AT sachikonyem correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy AT chwaulaj correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy AT flowersp correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy AT burnsf correctiontoacceptabilityofhivselfsamplingkitstinyvialamongpeopleofblackafricanethnicityintheukaqualitativestudy |