Cargando…

Toll-Like Receptor 4 (TLR4) Stimulates Synovial Injury of Temporomandibular Joint in Rats Through the Activation of p38 Mitogen-Activated Protein Kinase (MAPK) Signaling Pathway

BACKGROUND: Synovitis is an important disease that cause intractable pain in temporomandibular joint (TMJ), and the inflammation process played a crucial role in the initiation and development of temporomandibular joint disorder. A series of investigations suggested that the increasing expression of...

Descripción completa

Detalles Bibliográficos
Autores principales: Lin, Xuefen, Xie, Jianli, Sun, Shuzhen, Ren, Xusheng, Kong, Jingjing, Ji, Ping
Formato: Online Artículo Texto
Lenguaje:English
Publicado: International Scientific Literature, Inc. 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6053946/
https://www.ncbi.nlm.nih.gov/pubmed/29944647
http://dx.doi.org/10.12659/MSM.908526
_version_ 1783340922617987072
author Lin, Xuefen
Xie, Jianli
Sun, Shuzhen
Ren, Xusheng
Kong, Jingjing
Ji, Ping
author_facet Lin, Xuefen
Xie, Jianli
Sun, Shuzhen
Ren, Xusheng
Kong, Jingjing
Ji, Ping
author_sort Lin, Xuefen
collection PubMed
description BACKGROUND: Synovitis is an important disease that cause intractable pain in temporomandibular joint (TMJ), and the inflammation process played a crucial role in the initiation and development of temporomandibular joint disorder. A series of investigations suggested that the increasing expression of interleukin-(IL) 1β secreted by synovial lining cells plays an important role in synovial inflammation and cartilage destruction in TMJ. In this present study, we investigated the signaling pathways which regulate the expression of IL-1β. MATERIAL/METHODS: The occlusal interference animal model was created to induce synovial injury. Forty-eight rats were divided into 4 groups: 1) control group, 2) occlusal interference group, 3) TAK-242 (a specific inhibitor targeting the Toll-like receptor (TLR)-4) group, and 4) SB203580 (a specific inhibitor targeting the p38) group. The inflammation changes were observed, and the expression of p38 and IL-1β in the synovial membranes were assayed. RESULTS: The results showed that downstream p38 MAPK (mitogen-activated protein kinase) signaling was triggered following the activation of TLR4. Moreover, the injection of SB203580 could inhibit the inflammatory reactions and the increased expression of IL-1β at both mRNA and protein levels. CONCLUSIONS: The results prompted us that TLR4 may stimulates synovial inflammatory reactions and increased expression of IL-1β in rats through the activation of p38 MAPK signaling pathway, p38 was an important mediator in the mechanisms of the initiation and development of synovial injury by regulating the expression of IL-1β in synovial membranes.
format Online
Article
Text
id pubmed-6053946
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher International Scientific Literature, Inc.
record_format MEDLINE/PubMed
spelling pubmed-60539462018-07-24 Toll-Like Receptor 4 (TLR4) Stimulates Synovial Injury of Temporomandibular Joint in Rats Through the Activation of p38 Mitogen-Activated Protein Kinase (MAPK) Signaling Pathway Lin, Xuefen Xie, Jianli Sun, Shuzhen Ren, Xusheng Kong, Jingjing Ji, Ping Med Sci Monit Animal Study BACKGROUND: Synovitis is an important disease that cause intractable pain in temporomandibular joint (TMJ), and the inflammation process played a crucial role in the initiation and development of temporomandibular joint disorder. A series of investigations suggested that the increasing expression of interleukin-(IL) 1β secreted by synovial lining cells plays an important role in synovial inflammation and cartilage destruction in TMJ. In this present study, we investigated the signaling pathways which regulate the expression of IL-1β. MATERIAL/METHODS: The occlusal interference animal model was created to induce synovial injury. Forty-eight rats were divided into 4 groups: 1) control group, 2) occlusal interference group, 3) TAK-242 (a specific inhibitor targeting the Toll-like receptor (TLR)-4) group, and 4) SB203580 (a specific inhibitor targeting the p38) group. The inflammation changes were observed, and the expression of p38 and IL-1β in the synovial membranes were assayed. RESULTS: The results showed that downstream p38 MAPK (mitogen-activated protein kinase) signaling was triggered following the activation of TLR4. Moreover, the injection of SB203580 could inhibit the inflammatory reactions and the increased expression of IL-1β at both mRNA and protein levels. CONCLUSIONS: The results prompted us that TLR4 may stimulates synovial inflammatory reactions and increased expression of IL-1β in rats through the activation of p38 MAPK signaling pathway, p38 was an important mediator in the mechanisms of the initiation and development of synovial injury by regulating the expression of IL-1β in synovial membranes. International Scientific Literature, Inc. 2018-06-26 /pmc/articles/PMC6053946/ /pubmed/29944647 http://dx.doi.org/10.12659/MSM.908526 Text en © Med Sci Monit, 2018 This work is licensed under Creative Common Attribution-NonCommercial-NoDerivatives 4.0 International (CC BY-NC-ND 4.0 (https://creativecommons.org/licenses/by-nc-nd/4.0/) )
spellingShingle Animal Study
Lin, Xuefen
Xie, Jianli
Sun, Shuzhen
Ren, Xusheng
Kong, Jingjing
Ji, Ping
Toll-Like Receptor 4 (TLR4) Stimulates Synovial Injury of Temporomandibular Joint in Rats Through the Activation of p38 Mitogen-Activated Protein Kinase (MAPK) Signaling Pathway
title Toll-Like Receptor 4 (TLR4) Stimulates Synovial Injury of Temporomandibular Joint in Rats Through the Activation of p38 Mitogen-Activated Protein Kinase (MAPK) Signaling Pathway
title_full Toll-Like Receptor 4 (TLR4) Stimulates Synovial Injury of Temporomandibular Joint in Rats Through the Activation of p38 Mitogen-Activated Protein Kinase (MAPK) Signaling Pathway
title_fullStr Toll-Like Receptor 4 (TLR4) Stimulates Synovial Injury of Temporomandibular Joint in Rats Through the Activation of p38 Mitogen-Activated Protein Kinase (MAPK) Signaling Pathway
title_full_unstemmed Toll-Like Receptor 4 (TLR4) Stimulates Synovial Injury of Temporomandibular Joint in Rats Through the Activation of p38 Mitogen-Activated Protein Kinase (MAPK) Signaling Pathway
title_short Toll-Like Receptor 4 (TLR4) Stimulates Synovial Injury of Temporomandibular Joint in Rats Through the Activation of p38 Mitogen-Activated Protein Kinase (MAPK) Signaling Pathway
title_sort toll-like receptor 4 (tlr4) stimulates synovial injury of temporomandibular joint in rats through the activation of p38 mitogen-activated protein kinase (mapk) signaling pathway
topic Animal Study
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6053946/
https://www.ncbi.nlm.nih.gov/pubmed/29944647
http://dx.doi.org/10.12659/MSM.908526
work_keys_str_mv AT linxuefen tolllikereceptor4tlr4stimulatessynovialinjuryoftemporomandibularjointinratsthroughtheactivationofp38mitogenactivatedproteinkinasemapksignalingpathway
AT xiejianli tolllikereceptor4tlr4stimulatessynovialinjuryoftemporomandibularjointinratsthroughtheactivationofp38mitogenactivatedproteinkinasemapksignalingpathway
AT sunshuzhen tolllikereceptor4tlr4stimulatessynovialinjuryoftemporomandibularjointinratsthroughtheactivationofp38mitogenactivatedproteinkinasemapksignalingpathway
AT renxusheng tolllikereceptor4tlr4stimulatessynovialinjuryoftemporomandibularjointinratsthroughtheactivationofp38mitogenactivatedproteinkinasemapksignalingpathway
AT kongjingjing tolllikereceptor4tlr4stimulatessynovialinjuryoftemporomandibularjointinratsthroughtheactivationofp38mitogenactivatedproteinkinasemapksignalingpathway
AT jiping tolllikereceptor4tlr4stimulatessynovialinjuryoftemporomandibularjointinratsthroughtheactivationofp38mitogenactivatedproteinkinasemapksignalingpathway