Cargando…

Incomplete Refractory Kawasaki Disease in an Infant—A Case Report and a Review of the Literature

Kawasaki disease (KD) is a febrile vasculitis, which is commonly defined by fever and at least four specific clinical symptoms. Incomplete KD is defined by suggestive echocardiographic findings with an incomplete clinical picture. Refractory KD is diagnosed in patients resistant to intravenous immun...

Descripción completa

Detalles Bibliográficos
Autores principales: Mărginean, Cristina O., Meliț, Lorena E., Gozar, Liliana, Mărginean, Cristian Dan, Mărginean, Maria O.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6074057/
https://www.ncbi.nlm.nih.gov/pubmed/30101141
http://dx.doi.org/10.3389/fped.2018.00210
_version_ 1783344325243961344
author Mărginean, Cristina O.
Meliț, Lorena E.
Gozar, Liliana
Mărginean, Cristian Dan
Mărginean, Maria O.
author_facet Mărginean, Cristina O.
Meliț, Lorena E.
Gozar, Liliana
Mărginean, Cristian Dan
Mărginean, Maria O.
author_sort Mărginean, Cristina O.
collection PubMed
description Kawasaki disease (KD) is a febrile vasculitis, which is commonly defined by fever and at least four specific clinical symptoms. Incomplete KD is defined by suggestive echocardiographic findings with an incomplete clinical picture. Refractory KD is diagnosed in patients resistant to intravenous immunoglobulin (IVIG). We report the case of a 6-month-old male infant admitted to our clinic for persistent fever and onset of a generalized polymorphous rash, accompanied by high fever, rhinorrhea, and cough for the past 7 days. The laboratory tests, on the day of admission, revealed leukocytosis with neutrophilia, anemia, thrombocytosis, hypernatremia, hypoalbuminemia, elevated C-reactive protein (CRP), and erythrocyte sedimentation rate (ESR). Echocardiography showed dilation of the left anterior descending coronary artery (LAD). Based on all these findings, we established the diagnosis of KD, and we initiated IVIG and intravenous pulsed methylprednisolone, with an initial favorable outcome. However, the symptoms reappeared, and we administered a second higher single dose of IVIG, but without any clinical improvement. Moreover, the laboratory parameters and echocardiographic findings worsened. We reinitiated a longer course of intravenous methylprednisolone in a smaller dose, which had a favorable impact on the clinical, laboratory, and echocardiographic parameters. Multiple uncertainties exist related to the management of refractory KD despite the wide spectrum of therapeutic options that have been proposed. Our case demonstrates that in patients refractory to aggressive initial therapy, low or moderate doses of steroid given daily may be helpful.
format Online
Article
Text
id pubmed-6074057
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-60740572018-08-10 Incomplete Refractory Kawasaki Disease in an Infant—A Case Report and a Review of the Literature Mărginean, Cristina O. Meliț, Lorena E. Gozar, Liliana Mărginean, Cristian Dan Mărginean, Maria O. Front Pediatr Pediatrics Kawasaki disease (KD) is a febrile vasculitis, which is commonly defined by fever and at least four specific clinical symptoms. Incomplete KD is defined by suggestive echocardiographic findings with an incomplete clinical picture. Refractory KD is diagnosed in patients resistant to intravenous immunoglobulin (IVIG). We report the case of a 6-month-old male infant admitted to our clinic for persistent fever and onset of a generalized polymorphous rash, accompanied by high fever, rhinorrhea, and cough for the past 7 days. The laboratory tests, on the day of admission, revealed leukocytosis with neutrophilia, anemia, thrombocytosis, hypernatremia, hypoalbuminemia, elevated C-reactive protein (CRP), and erythrocyte sedimentation rate (ESR). Echocardiography showed dilation of the left anterior descending coronary artery (LAD). Based on all these findings, we established the diagnosis of KD, and we initiated IVIG and intravenous pulsed methylprednisolone, with an initial favorable outcome. However, the symptoms reappeared, and we administered a second higher single dose of IVIG, but without any clinical improvement. Moreover, the laboratory parameters and echocardiographic findings worsened. We reinitiated a longer course of intravenous methylprednisolone in a smaller dose, which had a favorable impact on the clinical, laboratory, and echocardiographic parameters. Multiple uncertainties exist related to the management of refractory KD despite the wide spectrum of therapeutic options that have been proposed. Our case demonstrates that in patients refractory to aggressive initial therapy, low or moderate doses of steroid given daily may be helpful. Frontiers Media S.A. 2018-07-27 /pmc/articles/PMC6074057/ /pubmed/30101141 http://dx.doi.org/10.3389/fped.2018.00210 Text en Copyright © 2018 Mărginean, Meliț, Gozar, Mărginean and Mărginean. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Pediatrics
Mărginean, Cristina O.
Meliț, Lorena E.
Gozar, Liliana
Mărginean, Cristian Dan
Mărginean, Maria O.
Incomplete Refractory Kawasaki Disease in an Infant—A Case Report and a Review of the Literature
title Incomplete Refractory Kawasaki Disease in an Infant—A Case Report and a Review of the Literature
title_full Incomplete Refractory Kawasaki Disease in an Infant—A Case Report and a Review of the Literature
title_fullStr Incomplete Refractory Kawasaki Disease in an Infant—A Case Report and a Review of the Literature
title_full_unstemmed Incomplete Refractory Kawasaki Disease in an Infant—A Case Report and a Review of the Literature
title_short Incomplete Refractory Kawasaki Disease in an Infant—A Case Report and a Review of the Literature
title_sort incomplete refractory kawasaki disease in an infant—a case report and a review of the literature
topic Pediatrics
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6074057/
https://www.ncbi.nlm.nih.gov/pubmed/30101141
http://dx.doi.org/10.3389/fped.2018.00210
work_keys_str_mv AT margineancristinao incompleterefractorykawasakidiseaseinaninfantacasereportandareviewoftheliterature
AT melitlorenae incompleterefractorykawasakidiseaseinaninfantacasereportandareviewoftheliterature
AT gozarliliana incompleterefractorykawasakidiseaseinaninfantacasereportandareviewoftheliterature
AT margineancristiandan incompleterefractorykawasakidiseaseinaninfantacasereportandareviewoftheliterature
AT margineanmariao incompleterefractorykawasakidiseaseinaninfantacasereportandareviewoftheliterature