Cargando…
Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers
INTRODUCTION: Nonfunctional pituitary adenomas are treated surgically, and even partial resection can improve or eliminate clinical symptoms. Notably, progression requires further intervention, which presents an increased risk, especially in older patients. This study investigated whether the histop...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6077672/ https://www.ncbi.nlm.nih.gov/pubmed/30112364 http://dx.doi.org/10.1155/2018/1876290 |
_version_ | 1783344967171702784 |
---|---|
author | Matoušek, Petr Buzrla, Petr Reguli, Štefan Krajča, Jan Dvořáčková, Jana Lipina, Radim |
author_facet | Matoušek, Petr Buzrla, Petr Reguli, Štefan Krajča, Jan Dvořáčková, Jana Lipina, Radim |
author_sort | Matoušek, Petr |
collection | PubMed |
description | INTRODUCTION: Nonfunctional pituitary adenomas are treated surgically, and even partial resection can improve or eliminate clinical symptoms. Notably, progression requires further intervention, which presents an increased risk, especially in older patients. This study investigated whether the histopathological characteristics of nonfunctional adenomas could predict recurrence. MATERIALS AND METHODS: Data were obtained retrospectively from 30 patients who underwent surgery for the partial resection of pituitary adenomas. Remnant tumor growth was observed in 17 patients, while the residual tumor was unchanged more than 7 years after surgery in 13 patients. Statistical analysis was performed to investigate correlations between remnant tumor progression and tumor histopathological findings, including protein expression of p21, p27, p53, and Ki-67. RESULTS AND DISCUSSION: Remnant tumors that demonstrated regrowth showed significantly higher protein expression of p21 and Ki-67. Expression of the p53 tumor suppressor was also higher in this group, but the difference was at the limit of statistical significance. CONCLUSION: Tumors with high expression of p21 and p53 and with a high Ki-67 index were more likely to show residual pituitary adenoma progression. Such cases should undergo frequent radiological examination and timely reoperation, and radiosurgery should be considered. |
format | Online Article Text |
id | pubmed-6077672 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-60776722018-08-15 Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers Matoušek, Petr Buzrla, Petr Reguli, Štefan Krajča, Jan Dvořáčková, Jana Lipina, Radim Biomed Res Int Research Article INTRODUCTION: Nonfunctional pituitary adenomas are treated surgically, and even partial resection can improve or eliminate clinical symptoms. Notably, progression requires further intervention, which presents an increased risk, especially in older patients. This study investigated whether the histopathological characteristics of nonfunctional adenomas could predict recurrence. MATERIALS AND METHODS: Data were obtained retrospectively from 30 patients who underwent surgery for the partial resection of pituitary adenomas. Remnant tumor growth was observed in 17 patients, while the residual tumor was unchanged more than 7 years after surgery in 13 patients. Statistical analysis was performed to investigate correlations between remnant tumor progression and tumor histopathological findings, including protein expression of p21, p27, p53, and Ki-67. RESULTS AND DISCUSSION: Remnant tumors that demonstrated regrowth showed significantly higher protein expression of p21 and Ki-67. Expression of the p53 tumor suppressor was also higher in this group, but the difference was at the limit of statistical significance. CONCLUSION: Tumors with high expression of p21 and p53 and with a high Ki-67 index were more likely to show residual pituitary adenoma progression. Such cases should undergo frequent radiological examination and timely reoperation, and radiosurgery should be considered. Hindawi 2018-07-10 /pmc/articles/PMC6077672/ /pubmed/30112364 http://dx.doi.org/10.1155/2018/1876290 Text en Copyright © 2018 Petr Matoušek et al. https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Matoušek, Petr Buzrla, Petr Reguli, Štefan Krajča, Jan Dvořáčková, Jana Lipina, Radim Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers |
title | Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers |
title_full | Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers |
title_fullStr | Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers |
title_full_unstemmed | Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers |
title_short | Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers |
title_sort | factors that predict the growth of residual nonfunctional pituitary adenomas: correlations between relapse and cell cycle markers |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6077672/ https://www.ncbi.nlm.nih.gov/pubmed/30112364 http://dx.doi.org/10.1155/2018/1876290 |
work_keys_str_mv | AT matousekpetr factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers AT buzrlapetr factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers AT regulistefan factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers AT krajcajan factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers AT dvorackovajana factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers AT lipinaradim factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers |