Cargando…

Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers

INTRODUCTION: Nonfunctional pituitary adenomas are treated surgically, and even partial resection can improve or eliminate clinical symptoms. Notably, progression requires further intervention, which presents an increased risk, especially in older patients. This study investigated whether the histop...

Descripción completa

Detalles Bibliográficos
Autores principales: Matoušek, Petr, Buzrla, Petr, Reguli, Štefan, Krajča, Jan, Dvořáčková, Jana, Lipina, Radim
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6077672/
https://www.ncbi.nlm.nih.gov/pubmed/30112364
http://dx.doi.org/10.1155/2018/1876290
_version_ 1783344967171702784
author Matoušek, Petr
Buzrla, Petr
Reguli, Štefan
Krajča, Jan
Dvořáčková, Jana
Lipina, Radim
author_facet Matoušek, Petr
Buzrla, Petr
Reguli, Štefan
Krajča, Jan
Dvořáčková, Jana
Lipina, Radim
author_sort Matoušek, Petr
collection PubMed
description INTRODUCTION: Nonfunctional pituitary adenomas are treated surgically, and even partial resection can improve or eliminate clinical symptoms. Notably, progression requires further intervention, which presents an increased risk, especially in older patients. This study investigated whether the histopathological characteristics of nonfunctional adenomas could predict recurrence. MATERIALS AND METHODS: Data were obtained retrospectively from 30 patients who underwent surgery for the partial resection of pituitary adenomas. Remnant tumor growth was observed in 17 patients, while the residual tumor was unchanged more than 7 years after surgery in 13 patients. Statistical analysis was performed to investigate correlations between remnant tumor progression and tumor histopathological findings, including protein expression of p21, p27, p53, and Ki-67. RESULTS AND DISCUSSION: Remnant tumors that demonstrated regrowth showed significantly higher protein expression of p21 and Ki-67. Expression of the p53 tumor suppressor was also higher in this group, but the difference was at the limit of statistical significance. CONCLUSION: Tumors with high expression of p21 and p53 and with a high Ki-67 index were more likely to show residual pituitary adenoma progression. Such cases should undergo frequent radiological examination and timely reoperation, and radiosurgery should be considered.
format Online
Article
Text
id pubmed-6077672
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Hindawi
record_format MEDLINE/PubMed
spelling pubmed-60776722018-08-15 Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers Matoušek, Petr Buzrla, Petr Reguli, Štefan Krajča, Jan Dvořáčková, Jana Lipina, Radim Biomed Res Int Research Article INTRODUCTION: Nonfunctional pituitary adenomas are treated surgically, and even partial resection can improve or eliminate clinical symptoms. Notably, progression requires further intervention, which presents an increased risk, especially in older patients. This study investigated whether the histopathological characteristics of nonfunctional adenomas could predict recurrence. MATERIALS AND METHODS: Data were obtained retrospectively from 30 patients who underwent surgery for the partial resection of pituitary adenomas. Remnant tumor growth was observed in 17 patients, while the residual tumor was unchanged more than 7 years after surgery in 13 patients. Statistical analysis was performed to investigate correlations between remnant tumor progression and tumor histopathological findings, including protein expression of p21, p27, p53, and Ki-67. RESULTS AND DISCUSSION: Remnant tumors that demonstrated regrowth showed significantly higher protein expression of p21 and Ki-67. Expression of the p53 tumor suppressor was also higher in this group, but the difference was at the limit of statistical significance. CONCLUSION: Tumors with high expression of p21 and p53 and with a high Ki-67 index were more likely to show residual pituitary adenoma progression. Such cases should undergo frequent radiological examination and timely reoperation, and radiosurgery should be considered. Hindawi 2018-07-10 /pmc/articles/PMC6077672/ /pubmed/30112364 http://dx.doi.org/10.1155/2018/1876290 Text en Copyright © 2018 Petr Matoušek et al. https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Matoušek, Petr
Buzrla, Petr
Reguli, Štefan
Krajča, Jan
Dvořáčková, Jana
Lipina, Radim
Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers
title Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers
title_full Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers
title_fullStr Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers
title_full_unstemmed Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers
title_short Factors That Predict the Growth of Residual Nonfunctional Pituitary Adenomas: Correlations between Relapse and Cell Cycle Markers
title_sort factors that predict the growth of residual nonfunctional pituitary adenomas: correlations between relapse and cell cycle markers
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6077672/
https://www.ncbi.nlm.nih.gov/pubmed/30112364
http://dx.doi.org/10.1155/2018/1876290
work_keys_str_mv AT matousekpetr factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers
AT buzrlapetr factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers
AT regulistefan factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers
AT krajcajan factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers
AT dvorackovajana factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers
AT lipinaradim factorsthatpredictthegrowthofresidualnonfunctionalpituitaryadenomascorrelationsbetweenrelapseandcellcyclemarkers