Cargando…
Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies
A series of eighteen pyrrolo[3,2-c]pyridine derivatives were tested for inhibitory effect against FMS kinase. Compounds 1e and 1r were the most potent among all the other tested analogues (IC(50) = 60 nM and 30 nM, respectively). They were 1.6 and 3.2 times, respectively, more potent than our lead c...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6084503/ https://www.ncbi.nlm.nih.gov/pubmed/30070930 http://dx.doi.org/10.1080/14756366.2018.1491563 |
_version_ | 1783346182191316992 |
---|---|
author | El-Gamal, Mohammed I. Oh, Chang-Hyun |
author_facet | El-Gamal, Mohammed I. Oh, Chang-Hyun |
author_sort | El-Gamal, Mohammed I. |
collection | PubMed |
description | A series of eighteen pyrrolo[3,2-c]pyridine derivatives were tested for inhibitory effect against FMS kinase. Compounds 1e and 1r were the most potent among all the other tested analogues (IC(50) = 60 nM and 30 nM, respectively). They were 1.6 and 3.2 times, respectively, more potent than our lead compound, KIST101029 (IC(50) = 96 nM). Compound 1r was tested over a panel of 40 kinases including FMS, and exerted selectivity against FMS kinase. It was further tested against bone marrow-derived macrophages (BMDM) and its IC(50) was 84 nM (2.32-fold more potent than KIST101029 (IC(50) = 195 nM)). Compound 1r was also tested for antiproliferative activity against a panel of six ovarian, two prostate, and five breast cancer cell lines, and its IC(50) values ranged from 0.15–1.78 µM. It possesses also the merit of selectivity towards cancer cells than normal fibroblasts. |
format | Online Article Text |
id | pubmed-6084503 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-60845032018-08-14 Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies El-Gamal, Mohammed I. Oh, Chang-Hyun J Enzyme Inhib Med Chem Research Paper A series of eighteen pyrrolo[3,2-c]pyridine derivatives were tested for inhibitory effect against FMS kinase. Compounds 1e and 1r were the most potent among all the other tested analogues (IC(50) = 60 nM and 30 nM, respectively). They were 1.6 and 3.2 times, respectively, more potent than our lead compound, KIST101029 (IC(50) = 96 nM). Compound 1r was tested over a panel of 40 kinases including FMS, and exerted selectivity against FMS kinase. It was further tested against bone marrow-derived macrophages (BMDM) and its IC(50) was 84 nM (2.32-fold more potent than KIST101029 (IC(50) = 195 nM)). Compound 1r was also tested for antiproliferative activity against a panel of six ovarian, two prostate, and five breast cancer cell lines, and its IC(50) values ranged from 0.15–1.78 µM. It possesses also the merit of selectivity towards cancer cells than normal fibroblasts. Taylor & Francis 2018-08-02 /pmc/articles/PMC6084503/ /pubmed/30070930 http://dx.doi.org/10.1080/14756366.2018.1491563 Text en © 2018 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Paper El-Gamal, Mohammed I. Oh, Chang-Hyun Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies |
title | Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies |
title_full | Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies |
title_fullStr | Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies |
title_full_unstemmed | Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies |
title_short | Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies |
title_sort | pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against fms kinase: in vitro biological studies |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6084503/ https://www.ncbi.nlm.nih.gov/pubmed/30070930 http://dx.doi.org/10.1080/14756366.2018.1491563 |
work_keys_str_mv | AT elgamalmohammedi pyrrolo32cpyridinederivativeswithpotentialinhibitoryeffectagainstfmskinaseinvitrobiologicalstudies AT ohchanghyun pyrrolo32cpyridinederivativeswithpotentialinhibitoryeffectagainstfmskinaseinvitrobiologicalstudies |