Cargando…

Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies

A series of eighteen pyrrolo[3,2-c]pyridine derivatives were tested for inhibitory effect against FMS kinase. Compounds 1e and 1r were the most potent among all the other tested analogues (IC(50) = 60 nM and 30 nM, respectively). They were 1.6 and 3.2 times, respectively, more potent than our lead c...

Descripción completa

Detalles Bibliográficos
Autores principales: El-Gamal, Mohammed I., Oh, Chang-Hyun
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6084503/
https://www.ncbi.nlm.nih.gov/pubmed/30070930
http://dx.doi.org/10.1080/14756366.2018.1491563
_version_ 1783346182191316992
author El-Gamal, Mohammed I.
Oh, Chang-Hyun
author_facet El-Gamal, Mohammed I.
Oh, Chang-Hyun
author_sort El-Gamal, Mohammed I.
collection PubMed
description A series of eighteen pyrrolo[3,2-c]pyridine derivatives were tested for inhibitory effect against FMS kinase. Compounds 1e and 1r were the most potent among all the other tested analogues (IC(50) = 60 nM and 30 nM, respectively). They were 1.6 and 3.2 times, respectively, more potent than our lead compound, KIST101029 (IC(50) = 96 nM). Compound 1r was tested over a panel of 40 kinases including FMS, and exerted selectivity against FMS kinase. It was further tested against bone marrow-derived macrophages (BMDM) and its IC(50) was 84 nM (2.32-fold more potent than KIST101029 (IC(50) = 195 nM)). Compound 1r was also tested for antiproliferative activity against a panel of six ovarian, two prostate, and five breast cancer cell lines, and its IC(50) values ranged from 0.15–1.78 µM. It possesses also the merit of selectivity towards cancer cells than normal fibroblasts.
format Online
Article
Text
id pubmed-6084503
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-60845032018-08-14 Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies El-Gamal, Mohammed I. Oh, Chang-Hyun J Enzyme Inhib Med Chem Research Paper A series of eighteen pyrrolo[3,2-c]pyridine derivatives were tested for inhibitory effect against FMS kinase. Compounds 1e and 1r were the most potent among all the other tested analogues (IC(50) = 60 nM and 30 nM, respectively). They were 1.6 and 3.2 times, respectively, more potent than our lead compound, KIST101029 (IC(50) = 96 nM). Compound 1r was tested over a panel of 40 kinases including FMS, and exerted selectivity against FMS kinase. It was further tested against bone marrow-derived macrophages (BMDM) and its IC(50) was 84 nM (2.32-fold more potent than KIST101029 (IC(50) = 195 nM)). Compound 1r was also tested for antiproliferative activity against a panel of six ovarian, two prostate, and five breast cancer cell lines, and its IC(50) values ranged from 0.15–1.78 µM. It possesses also the merit of selectivity towards cancer cells than normal fibroblasts. Taylor & Francis 2018-08-02 /pmc/articles/PMC6084503/ /pubmed/30070930 http://dx.doi.org/10.1080/14756366.2018.1491563 Text en © 2018 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Paper
El-Gamal, Mohammed I.
Oh, Chang-Hyun
Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies
title Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies
title_full Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies
title_fullStr Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies
title_full_unstemmed Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies
title_short Pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against FMS kinase: in vitro biological studies
title_sort pyrrolo[3,2-c]pyridine derivatives with potential inhibitory effect against fms kinase: in vitro biological studies
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6084503/
https://www.ncbi.nlm.nih.gov/pubmed/30070930
http://dx.doi.org/10.1080/14756366.2018.1491563
work_keys_str_mv AT elgamalmohammedi pyrrolo32cpyridinederivativeswithpotentialinhibitoryeffectagainstfmskinaseinvitrobiologicalstudies
AT ohchanghyun pyrrolo32cpyridinederivativeswithpotentialinhibitoryeffectagainstfmskinaseinvitrobiologicalstudies