Cargando…

Survey for major viruses in commercial Vitis vinifera wine grapes in Ontario

BACKGROUND: In recent years, the Ontario grape and wine industry has experienced outbreaks of viral diseases across the province. Little is known about the prevalence of viruses and viral diseases in Ontario. Since 2015, we have conducted large-scale surveys for major viruses in commercial wine grap...

Descripción completa

Detalles Bibliográficos
Autores principales: Xiao, Huogen, Shabanian, Mehdi, Moore, Clayton, Li, Caihong, Meng, Baozhong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6090770/
https://www.ncbi.nlm.nih.gov/pubmed/30103767
http://dx.doi.org/10.1186/s12985-018-1036-1
_version_ 1783347255365861376
author Xiao, Huogen
Shabanian, Mehdi
Moore, Clayton
Li, Caihong
Meng, Baozhong
author_facet Xiao, Huogen
Shabanian, Mehdi
Moore, Clayton
Li, Caihong
Meng, Baozhong
author_sort Xiao, Huogen
collection PubMed
description BACKGROUND: In recent years, the Ontario grape and wine industry has experienced outbreaks of viral diseases across the province. Little is known about the prevalence of viruses and viral diseases in Ontario. Since 2015, we have conducted large-scale surveys for major viruses in commercial wine grapes in order to obtain a comprehensive understanding of the prevalence and severity of viral diseases in Ontario. METHODS: A total of 657 composite leaf samples representing 3285 vines collected from 137 vine blocks of 33 vineyards from three appellations: Niagara Peninsula, Lake Erie North Shore and Prince Edward County. These samples covered six major red cultivars and five major white grape cultivars. Using a multiplex RT-PCR format, we tested these samples for 17 viruses including those involved in all major viral diseases of the grapevine, such as five grapevine leafroll-associated viruses (GLRaV-1, 2, 3, 4, 7), grapevine red blotch virus (GRBV), grapevine Pinot gris virus (GPGV), grapevine rupestris stem sitting-associated virus (GRSPaV), grapevine virus A (GVA), grapevine virus B (GVB), grapevine fleck virus (GFkV), arabis mosaic virus (ArMV), tomato ringspot virus (ToRSV), trapevine fanleaf virus (GFLV), among others. RESULTS: Fourteen of the 17 viruses were detected from these samples and the predominant viruses are GRSPaV, GLRaV-3, GFkV, GPGV and GRBaV with an incidence of 84.0, 47.9, 21.8, 21.6 and 18.3%, respectively. As expected, mixed infections with multiple viruses are common. 95.6% of the samples included in the survey were infected with at least one virus; 67% of the samples with 2–4 viruses and 4.7% of the samples with 5–6 viruses. The major grape cultivars all tested positive for these major viruses. The results also suggested that the use of infected planting material may have been one of the chief factors responsible for the recent outbreaks of viral diseases across the province. CONCLUSIONS: This is the first such comprehensive survey for grapevine viruses in Ontario and one of the most extensive surveys ever conducted in Canada. The recent outbreaks of viral diseases in Ontario vineyards were likely caused by GLRaV-3, GRBV and GPGV. Findings from this survey provides a baseline for the grape and wine industry in developing strategies for managing grapevine viral diseases in Ontario vineyards.
format Online
Article
Text
id pubmed-6090770
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-60907702018-08-17 Survey for major viruses in commercial Vitis vinifera wine grapes in Ontario Xiao, Huogen Shabanian, Mehdi Moore, Clayton Li, Caihong Meng, Baozhong Virol J Research BACKGROUND: In recent years, the Ontario grape and wine industry has experienced outbreaks of viral diseases across the province. Little is known about the prevalence of viruses and viral diseases in Ontario. Since 2015, we have conducted large-scale surveys for major viruses in commercial wine grapes in order to obtain a comprehensive understanding of the prevalence and severity of viral diseases in Ontario. METHODS: A total of 657 composite leaf samples representing 3285 vines collected from 137 vine blocks of 33 vineyards from three appellations: Niagara Peninsula, Lake Erie North Shore and Prince Edward County. These samples covered six major red cultivars and five major white grape cultivars. Using a multiplex RT-PCR format, we tested these samples for 17 viruses including those involved in all major viral diseases of the grapevine, such as five grapevine leafroll-associated viruses (GLRaV-1, 2, 3, 4, 7), grapevine red blotch virus (GRBV), grapevine Pinot gris virus (GPGV), grapevine rupestris stem sitting-associated virus (GRSPaV), grapevine virus A (GVA), grapevine virus B (GVB), grapevine fleck virus (GFkV), arabis mosaic virus (ArMV), tomato ringspot virus (ToRSV), trapevine fanleaf virus (GFLV), among others. RESULTS: Fourteen of the 17 viruses were detected from these samples and the predominant viruses are GRSPaV, GLRaV-3, GFkV, GPGV and GRBaV with an incidence of 84.0, 47.9, 21.8, 21.6 and 18.3%, respectively. As expected, mixed infections with multiple viruses are common. 95.6% of the samples included in the survey were infected with at least one virus; 67% of the samples with 2–4 viruses and 4.7% of the samples with 5–6 viruses. The major grape cultivars all tested positive for these major viruses. The results also suggested that the use of infected planting material may have been one of the chief factors responsible for the recent outbreaks of viral diseases across the province. CONCLUSIONS: This is the first such comprehensive survey for grapevine viruses in Ontario and one of the most extensive surveys ever conducted in Canada. The recent outbreaks of viral diseases in Ontario vineyards were likely caused by GLRaV-3, GRBV and GPGV. Findings from this survey provides a baseline for the grape and wine industry in developing strategies for managing grapevine viral diseases in Ontario vineyards. BioMed Central 2018-08-13 /pmc/articles/PMC6090770/ /pubmed/30103767 http://dx.doi.org/10.1186/s12985-018-1036-1 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Xiao, Huogen
Shabanian, Mehdi
Moore, Clayton
Li, Caihong
Meng, Baozhong
Survey for major viruses in commercial Vitis vinifera wine grapes in Ontario
title Survey for major viruses in commercial Vitis vinifera wine grapes in Ontario
title_full Survey for major viruses in commercial Vitis vinifera wine grapes in Ontario
title_fullStr Survey for major viruses in commercial Vitis vinifera wine grapes in Ontario
title_full_unstemmed Survey for major viruses in commercial Vitis vinifera wine grapes in Ontario
title_short Survey for major viruses in commercial Vitis vinifera wine grapes in Ontario
title_sort survey for major viruses in commercial vitis vinifera wine grapes in ontario
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6090770/
https://www.ncbi.nlm.nih.gov/pubmed/30103767
http://dx.doi.org/10.1186/s12985-018-1036-1
work_keys_str_mv AT xiaohuogen surveyformajorvirusesincommercialvitisviniferawinegrapesinontario
AT shabanianmehdi surveyformajorvirusesincommercialvitisviniferawinegrapesinontario
AT mooreclayton surveyformajorvirusesincommercialvitisviniferawinegrapesinontario
AT licaihong surveyformajorvirusesincommercialvitisviniferawinegrapesinontario
AT mengbaozhong surveyformajorvirusesincommercialvitisviniferawinegrapesinontario