Cargando…
Construction of a high-density genetic map and fine QTL mapping for growth and nutritional traits of Crassostrea gigas
BACKGROUND: Both growth and nutritional traits are important economic traits of Crassostrea gigas (C. gigas) in industry. But few work has been done to study the genetic architecture of nutritional traits of the oyster. In this study, we constructed a high-density genetic map of C. gigas to help ass...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6106840/ https://www.ncbi.nlm.nih.gov/pubmed/30134839 http://dx.doi.org/10.1186/s12864-018-4996-z |
_version_ | 1783349855209390080 |
---|---|
author | Li, Chunyan Wang, Jinpeng Song, Kai Meng, Jie Xu, Fei Li, Li Zhang, Guofan |
author_facet | Li, Chunyan Wang, Jinpeng Song, Kai Meng, Jie Xu, Fei Li, Li Zhang, Guofan |
author_sort | Li, Chunyan |
collection | PubMed |
description | BACKGROUND: Both growth and nutritional traits are important economic traits of Crassostrea gigas (C. gigas) in industry. But few work has been done to study the genetic architecture of nutritional traits of the oyster. In this study, we constructed a high-density genetic map of C. gigas to help assemble the genome sequence onto chromosomes, meanwhile explore the genetic basis for nutritional traits via quantitative trait loci (QTL) mapping. RESULTS: The constructed genetic map contained 5024 evenly distributed markers, with an average marker interval of 0.68 cM, thus representing the densest genetic map produced for the oyster. According to the high collinearity between the consensus map and the oyster genome, 1574 scaffold (about 70%) of the genome sequence of C. gigas were successfully anchored to 10 linkage groups (LGs) of the consensus map. Using this high-qualified genetic map, we then conducted QTL analysis for growth and nutritional traits, the latter of which includes glycogen, amino acid (AA), and fatty acid (FA). Overall, 41 QTLs were detected for 17 traits. In addition, six candidate genes identified in the QTL interval showed significant correlation with the traits on transcriptional levels. These genes include growth-related genes AMY and BMP1, AA metabolism related genes PLSCR and GR, and FA metabolism regulation genes DYRK and ADAMTS. CONCLUSION: Using the constructed high-qualified linkage map, this study not only assembled nearly 70% of the oyster genome sequence onto chromosomes, but also identified valuable markers and candidate genes for growth and nutritional traits, especially for AA and FA that undergone few studies before. These findings will facilitate genome assembly and molecular breeding of important economic traits in C. gigas. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12864-018-4996-z) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6106840 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-61068402018-08-29 Construction of a high-density genetic map and fine QTL mapping for growth and nutritional traits of Crassostrea gigas Li, Chunyan Wang, Jinpeng Song, Kai Meng, Jie Xu, Fei Li, Li Zhang, Guofan BMC Genomics Research Article BACKGROUND: Both growth and nutritional traits are important economic traits of Crassostrea gigas (C. gigas) in industry. But few work has been done to study the genetic architecture of nutritional traits of the oyster. In this study, we constructed a high-density genetic map of C. gigas to help assemble the genome sequence onto chromosomes, meanwhile explore the genetic basis for nutritional traits via quantitative trait loci (QTL) mapping. RESULTS: The constructed genetic map contained 5024 evenly distributed markers, with an average marker interval of 0.68 cM, thus representing the densest genetic map produced for the oyster. According to the high collinearity between the consensus map and the oyster genome, 1574 scaffold (about 70%) of the genome sequence of C. gigas were successfully anchored to 10 linkage groups (LGs) of the consensus map. Using this high-qualified genetic map, we then conducted QTL analysis for growth and nutritional traits, the latter of which includes glycogen, amino acid (AA), and fatty acid (FA). Overall, 41 QTLs were detected for 17 traits. In addition, six candidate genes identified in the QTL interval showed significant correlation with the traits on transcriptional levels. These genes include growth-related genes AMY and BMP1, AA metabolism related genes PLSCR and GR, and FA metabolism regulation genes DYRK and ADAMTS. CONCLUSION: Using the constructed high-qualified linkage map, this study not only assembled nearly 70% of the oyster genome sequence onto chromosomes, but also identified valuable markers and candidate genes for growth and nutritional traits, especially for AA and FA that undergone few studies before. These findings will facilitate genome assembly and molecular breeding of important economic traits in C. gigas. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12864-018-4996-z) contains supplementary material, which is available to authorized users. BioMed Central 2018-08-22 /pmc/articles/PMC6106840/ /pubmed/30134839 http://dx.doi.org/10.1186/s12864-018-4996-z Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Li, Chunyan Wang, Jinpeng Song, Kai Meng, Jie Xu, Fei Li, Li Zhang, Guofan Construction of a high-density genetic map and fine QTL mapping for growth and nutritional traits of Crassostrea gigas |
title | Construction of a high-density genetic map and fine QTL mapping for growth and nutritional traits of Crassostrea gigas |
title_full | Construction of a high-density genetic map and fine QTL mapping for growth and nutritional traits of Crassostrea gigas |
title_fullStr | Construction of a high-density genetic map and fine QTL mapping for growth and nutritional traits of Crassostrea gigas |
title_full_unstemmed | Construction of a high-density genetic map and fine QTL mapping for growth and nutritional traits of Crassostrea gigas |
title_short | Construction of a high-density genetic map and fine QTL mapping for growth and nutritional traits of Crassostrea gigas |
title_sort | construction of a high-density genetic map and fine qtl mapping for growth and nutritional traits of crassostrea gigas |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6106840/ https://www.ncbi.nlm.nih.gov/pubmed/30134839 http://dx.doi.org/10.1186/s12864-018-4996-z |
work_keys_str_mv | AT lichunyan constructionofahighdensitygeneticmapandfineqtlmappingforgrowthandnutritionaltraitsofcrassostreagigas AT wangjinpeng constructionofahighdensitygeneticmapandfineqtlmappingforgrowthandnutritionaltraitsofcrassostreagigas AT songkai constructionofahighdensitygeneticmapandfineqtlmappingforgrowthandnutritionaltraitsofcrassostreagigas AT mengjie constructionofahighdensitygeneticmapandfineqtlmappingforgrowthandnutritionaltraitsofcrassostreagigas AT xufei constructionofahighdensitygeneticmapandfineqtlmappingforgrowthandnutritionaltraitsofcrassostreagigas AT lili constructionofahighdensitygeneticmapandfineqtlmappingforgrowthandnutritionaltraitsofcrassostreagigas AT zhangguofan constructionofahighdensitygeneticmapandfineqtlmappingforgrowthandnutritionaltraitsofcrassostreagigas |