Cargando…
Using the capabilities approach to understand inequality in primary health-care services for people with severe mental illness
BACKGROUND: Epidemiological studies show disparities in the provision of physical health-care for people with severe mental illness. This observation includes countries with universal health insurance. However, there is limited in-depth data regarding the barriers preventing equality of physical hea...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6109982/ https://www.ncbi.nlm.nih.gov/pubmed/30145980 http://dx.doi.org/10.1186/s13584-018-0236-x |
_version_ | 1783350401372782592 |
---|---|
author | Lavie-Ajayi, Maya Moran, Galia S. Levav, Itzhak Porat, Rotem Reches, Tal Goldfracht, Margalit Gal, Gilad |
author_facet | Lavie-Ajayi, Maya Moran, Galia S. Levav, Itzhak Porat, Rotem Reches, Tal Goldfracht, Margalit Gal, Gilad |
author_sort | Lavie-Ajayi, Maya |
collection | PubMed |
description | BACKGROUND: Epidemiological studies show disparities in the provision of physical health-care for people with severe mental illness. This observation includes countries with universal health insurance. However, there is limited in-depth data regarding the barriers preventing equality of physical health-care provision for this population. This study applied the capabilities approach to examine the interface between general practitioners and patients with severe mental illness. The capabilities approach provides a framework for health status which conceptualizes the internal and external factors relating to the available options (capabilities) and subsequent health outcomes (functioning). METHODS: Semi-structured in-depth interviews were conducted with 10 general practitioners and 15 patients with severe mental illness, and then thematically analyzed. Results: We identified factors manifesting across three levels: personal, relational-societal, and organizational. At the personal level, the utilization of physical health services was impaired by the exacerbation of psychiatric symptoms. At the relational level, both patients and physicians described the importance of a long-term and trusting relationship, and provided examples demonstrating the implications of relational ruptures. Finally, two structural-level impediments were described by the physicians: the absence of continuous monitoring of patients with severe mental illness, and the shortfall in psychosocial interventions. CONCLUSION: The capability approach facilitated the identification of barriers preventing equitable health-care provision for patients with severe mental illness. Based on our findings, we propose a number of practical suggestions to improve physical health-care for this population: 1. A proactive approach in monitoring patients’ health status and utilization of services. 2. Acknowledgment of people with severe mental illness as a vulnerable population at risk, that need increased time for physician-patient consultations. 3. Training and support for general practitioners. 4. Increase collaboration between general practitioners and mental-health professionals. 5. Educational programs for health professionals to reduce prejudice against people with severe mental illness. |
format | Online Article Text |
id | pubmed-6109982 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-61099822018-08-28 Using the capabilities approach to understand inequality in primary health-care services for people with severe mental illness Lavie-Ajayi, Maya Moran, Galia S. Levav, Itzhak Porat, Rotem Reches, Tal Goldfracht, Margalit Gal, Gilad Isr J Health Policy Res Original Research Article BACKGROUND: Epidemiological studies show disparities in the provision of physical health-care for people with severe mental illness. This observation includes countries with universal health insurance. However, there is limited in-depth data regarding the barriers preventing equality of physical health-care provision for this population. This study applied the capabilities approach to examine the interface between general practitioners and patients with severe mental illness. The capabilities approach provides a framework for health status which conceptualizes the internal and external factors relating to the available options (capabilities) and subsequent health outcomes (functioning). METHODS: Semi-structured in-depth interviews were conducted with 10 general practitioners and 15 patients with severe mental illness, and then thematically analyzed. Results: We identified factors manifesting across three levels: personal, relational-societal, and organizational. At the personal level, the utilization of physical health services was impaired by the exacerbation of psychiatric symptoms. At the relational level, both patients and physicians described the importance of a long-term and trusting relationship, and provided examples demonstrating the implications of relational ruptures. Finally, two structural-level impediments were described by the physicians: the absence of continuous monitoring of patients with severe mental illness, and the shortfall in psychosocial interventions. CONCLUSION: The capability approach facilitated the identification of barriers preventing equitable health-care provision for patients with severe mental illness. Based on our findings, we propose a number of practical suggestions to improve physical health-care for this population: 1. A proactive approach in monitoring patients’ health status and utilization of services. 2. Acknowledgment of people with severe mental illness as a vulnerable population at risk, that need increased time for physician-patient consultations. 3. Training and support for general practitioners. 4. Increase collaboration between general practitioners and mental-health professionals. 5. Educational programs for health professionals to reduce prejudice against people with severe mental illness. BioMed Central 2018-08-27 /pmc/articles/PMC6109982/ /pubmed/30145980 http://dx.doi.org/10.1186/s13584-018-0236-x Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Original Research Article Lavie-Ajayi, Maya Moran, Galia S. Levav, Itzhak Porat, Rotem Reches, Tal Goldfracht, Margalit Gal, Gilad Using the capabilities approach to understand inequality in primary health-care services for people with severe mental illness |
title | Using the capabilities approach to understand inequality in primary health-care services for people with severe mental illness |
title_full | Using the capabilities approach to understand inequality in primary health-care services for people with severe mental illness |
title_fullStr | Using the capabilities approach to understand inequality in primary health-care services for people with severe mental illness |
title_full_unstemmed | Using the capabilities approach to understand inequality in primary health-care services for people with severe mental illness |
title_short | Using the capabilities approach to understand inequality in primary health-care services for people with severe mental illness |
title_sort | using the capabilities approach to understand inequality in primary health-care services for people with severe mental illness |
topic | Original Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6109982/ https://www.ncbi.nlm.nih.gov/pubmed/30145980 http://dx.doi.org/10.1186/s13584-018-0236-x |
work_keys_str_mv | AT lavieajayimaya usingthecapabilitiesapproachtounderstandinequalityinprimaryhealthcareservicesforpeoplewithseverementalillness AT morangalias usingthecapabilitiesapproachtounderstandinequalityinprimaryhealthcareservicesforpeoplewithseverementalillness AT levavitzhak usingthecapabilitiesapproachtounderstandinequalityinprimaryhealthcareservicesforpeoplewithseverementalillness AT poratrotem usingthecapabilitiesapproachtounderstandinequalityinprimaryhealthcareservicesforpeoplewithseverementalillness AT rechestal usingthecapabilitiesapproachtounderstandinequalityinprimaryhealthcareservicesforpeoplewithseverementalillness AT goldfrachtmargalit usingthecapabilitiesapproachtounderstandinequalityinprimaryhealthcareservicesforpeoplewithseverementalillness AT galgilad usingthecapabilitiesapproachtounderstandinequalityinprimaryhealthcareservicesforpeoplewithseverementalillness |