Cargando…

Role of the Spleen Tyrosine Kinase Pathway in Driving Inflammation in IgA Nephropathy

Summary: IgA nephropathy is the most common type of primary glomerulonephritis worldwide. At least 25% of patients may progress to kidney failure requiring dialysis or transplantation. Treatment of IgA nephropathy using generalized immunosuppression is controversial, with concerns regarding the bala...

Descripción completa

Detalles Bibliográficos
Autores principales: McAdoo, Stephen, Tam, Frederick W.K.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: W.B. Saunders 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6135887/
https://www.ncbi.nlm.nih.gov/pubmed/30177021
http://dx.doi.org/10.1016/j.semnephrol.2018.05.019
_version_ 1783354897109876736
author McAdoo, Stephen
Tam, Frederick W.K.
author_facet McAdoo, Stephen
Tam, Frederick W.K.
author_sort McAdoo, Stephen
collection PubMed
description Summary: IgA nephropathy is the most common type of primary glomerulonephritis worldwide. At least 25% of patients may progress to kidney failure requiring dialysis or transplantation. Treatment of IgA nephropathy using generalized immunosuppression is controversial, with concerns regarding the balance of safety and efficacy in a nonspecific approach. This review describes the recent scientific evidence, and a current clinical trial, investigating whether spleen tyrosine kinase (SYK) may be a novel and selective therapeutic target for IgA nephropathy. SYK, a cytoplasmic tyrosine kinase, has a pivotal role as an early intermediate in intracellular signal transduction cascades for the B-cell receptor and the immunoglobulin Fc receptor, and thus is critical for B-cell proliferation, differentiation, and activation, and for mediating proinflammatory responses after Fc-receptor engagement in various cell types. In renal biopsy specimens of patients with IgA nephropathy, increased expression and phosphorylation of SYK were detected, and this correlated with the histologic features of mesangial and endocapillary proliferation. In cell culture studies, patient-derived IgA1 stimulated mesangial cell SYK activation, cell proliferation, and cytokine production, and these responses were attenuated by pharmacologic or molecular inhibition of SYK. A global, randomized, double-blind, placebo-controlled trial investigating the safety and efficacy of fostamatinib (an oral prodrug SYK inhibitor) in the treatment of patients with IgA nephropathy is ongoing, which may provide important evidence of the safety and efficacy of targeting this pathway in clinical disease.
format Online
Article
Text
id pubmed-6135887
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher W.B. Saunders
record_format MEDLINE/PubMed
spelling pubmed-61358872018-09-19 Role of the Spleen Tyrosine Kinase Pathway in Driving Inflammation in IgA Nephropathy McAdoo, Stephen Tam, Frederick W.K. Semin Nephrol Article Summary: IgA nephropathy is the most common type of primary glomerulonephritis worldwide. At least 25% of patients may progress to kidney failure requiring dialysis or transplantation. Treatment of IgA nephropathy using generalized immunosuppression is controversial, with concerns regarding the balance of safety and efficacy in a nonspecific approach. This review describes the recent scientific evidence, and a current clinical trial, investigating whether spleen tyrosine kinase (SYK) may be a novel and selective therapeutic target for IgA nephropathy. SYK, a cytoplasmic tyrosine kinase, has a pivotal role as an early intermediate in intracellular signal transduction cascades for the B-cell receptor and the immunoglobulin Fc receptor, and thus is critical for B-cell proliferation, differentiation, and activation, and for mediating proinflammatory responses after Fc-receptor engagement in various cell types. In renal biopsy specimens of patients with IgA nephropathy, increased expression and phosphorylation of SYK were detected, and this correlated with the histologic features of mesangial and endocapillary proliferation. In cell culture studies, patient-derived IgA1 stimulated mesangial cell SYK activation, cell proliferation, and cytokine production, and these responses were attenuated by pharmacologic or molecular inhibition of SYK. A global, randomized, double-blind, placebo-controlled trial investigating the safety and efficacy of fostamatinib (an oral prodrug SYK inhibitor) in the treatment of patients with IgA nephropathy is ongoing, which may provide important evidence of the safety and efficacy of targeting this pathway in clinical disease. W.B. Saunders 2018-09 /pmc/articles/PMC6135887/ /pubmed/30177021 http://dx.doi.org/10.1016/j.semnephrol.2018.05.019 Text en © The Authors. Published by Elsevier Inc. http://creativecommons.org/licenses/by/4.0/ This is an open access article under the CC BY license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
McAdoo, Stephen
Tam, Frederick W.K.
Role of the Spleen Tyrosine Kinase Pathway in Driving Inflammation in IgA Nephropathy
title Role of the Spleen Tyrosine Kinase Pathway in Driving Inflammation in IgA Nephropathy
title_full Role of the Spleen Tyrosine Kinase Pathway in Driving Inflammation in IgA Nephropathy
title_fullStr Role of the Spleen Tyrosine Kinase Pathway in Driving Inflammation in IgA Nephropathy
title_full_unstemmed Role of the Spleen Tyrosine Kinase Pathway in Driving Inflammation in IgA Nephropathy
title_short Role of the Spleen Tyrosine Kinase Pathway in Driving Inflammation in IgA Nephropathy
title_sort role of the spleen tyrosine kinase pathway in driving inflammation in iga nephropathy
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6135887/
https://www.ncbi.nlm.nih.gov/pubmed/30177021
http://dx.doi.org/10.1016/j.semnephrol.2018.05.019
work_keys_str_mv AT mcadoostephen roleofthespleentyrosinekinasepathwayindrivinginflammationiniganephropathy
AT tamfrederickwk roleofthespleentyrosinekinasepathwayindrivinginflammationiniganephropathy