Cargando…

Psychological adjustment, quality of life, and self-perceptions of reproductive health in males with congenital adrenal hyperplasia: a systematic review

PURPOSE: Congenital adrenal hyperplasia (CAH) has been shown to potentially affect psychological adjustment. However, most research has focused on females, and knowledge about psychological challenges in males remains sparse. The aim of this systematic review was therefore to assess these in males w...

Descripción completa

Detalles Bibliográficos
Autores principales: Daae, Elisabeth, Feragen, Kristin Billaud, Nermoen, Ingrid, Falhammar, Henrik
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Springer US 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6153586/
https://www.ncbi.nlm.nih.gov/pubmed/30128958
http://dx.doi.org/10.1007/s12020-018-1723-0
_version_ 1783357532740255744
author Daae, Elisabeth
Feragen, Kristin Billaud
Nermoen, Ingrid
Falhammar, Henrik
author_facet Daae, Elisabeth
Feragen, Kristin Billaud
Nermoen, Ingrid
Falhammar, Henrik
author_sort Daae, Elisabeth
collection PubMed
description PURPOSE: Congenital adrenal hyperplasia (CAH) has been shown to potentially affect psychological adjustment. However, most research has focused on females, and knowledge about psychological challenges in males remains sparse. The aim of this systematic review was therefore to assess these in males with CAH. METHODS: We systematically searched the OVID Medline, PsycINFO, CINAHL, and Web of Science databases, for articles published up to April 20, 2018, investigating psychological adjustment in males with CAH. RESULTS: Eleven studies were included in the review. Three main health domains were identified: psychological and psychiatric health, quality of life (QoL), and self-perceptions of reproductive health. Some studies covered more than one health domain. Seven studies explored psychological adjustment and/or the presence of psychiatric symptoms or disorders. Results indicated that males with CAH had more problems related to internalizing behaviors (negative behaviors directed toward the self) and more negative emotionality compared to reference groups. Six studies examined QoL, five of them reporting reduced QoL compared to reference groups. Three studies explored the impact of fertility and sexual health issues on psychological health with varying results from impaired to normal sexual well-being. CONCLUSIONS: CAH seems to have an impact on males' psychological health. However, the number of identified studies was limited, included few participants, and revealed divergent findings, demonstrating the need for larger studies and highlighting a number of methodological challenges that should be addressed by future research.
format Online
Article
Text
id pubmed-6153586
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Springer US
record_format MEDLINE/PubMed
spelling pubmed-61535862018-10-04 Psychological adjustment, quality of life, and self-perceptions of reproductive health in males with congenital adrenal hyperplasia: a systematic review Daae, Elisabeth Feragen, Kristin Billaud Nermoen, Ingrid Falhammar, Henrik Endocrine Review PURPOSE: Congenital adrenal hyperplasia (CAH) has been shown to potentially affect psychological adjustment. However, most research has focused on females, and knowledge about psychological challenges in males remains sparse. The aim of this systematic review was therefore to assess these in males with CAH. METHODS: We systematically searched the OVID Medline, PsycINFO, CINAHL, and Web of Science databases, for articles published up to April 20, 2018, investigating psychological adjustment in males with CAH. RESULTS: Eleven studies were included in the review. Three main health domains were identified: psychological and psychiatric health, quality of life (QoL), and self-perceptions of reproductive health. Some studies covered more than one health domain. Seven studies explored psychological adjustment and/or the presence of psychiatric symptoms or disorders. Results indicated that males with CAH had more problems related to internalizing behaviors (negative behaviors directed toward the self) and more negative emotionality compared to reference groups. Six studies examined QoL, five of them reporting reduced QoL compared to reference groups. Three studies explored the impact of fertility and sexual health issues on psychological health with varying results from impaired to normal sexual well-being. CONCLUSIONS: CAH seems to have an impact on males' psychological health. However, the number of identified studies was limited, included few participants, and revealed divergent findings, demonstrating the need for larger studies and highlighting a number of methodological challenges that should be addressed by future research. Springer US 2018-08-20 2018 /pmc/articles/PMC6153586/ /pubmed/30128958 http://dx.doi.org/10.1007/s12020-018-1723-0 Text en © The Author(s) 2018 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits use, duplication, adaptation, distribution, and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.
spellingShingle Review
Daae, Elisabeth
Feragen, Kristin Billaud
Nermoen, Ingrid
Falhammar, Henrik
Psychological adjustment, quality of life, and self-perceptions of reproductive health in males with congenital adrenal hyperplasia: a systematic review
title Psychological adjustment, quality of life, and self-perceptions of reproductive health in males with congenital adrenal hyperplasia: a systematic review
title_full Psychological adjustment, quality of life, and self-perceptions of reproductive health in males with congenital adrenal hyperplasia: a systematic review
title_fullStr Psychological adjustment, quality of life, and self-perceptions of reproductive health in males with congenital adrenal hyperplasia: a systematic review
title_full_unstemmed Psychological adjustment, quality of life, and self-perceptions of reproductive health in males with congenital adrenal hyperplasia: a systematic review
title_short Psychological adjustment, quality of life, and self-perceptions of reproductive health in males with congenital adrenal hyperplasia: a systematic review
title_sort psychological adjustment, quality of life, and self-perceptions of reproductive health in males with congenital adrenal hyperplasia: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6153586/
https://www.ncbi.nlm.nih.gov/pubmed/30128958
http://dx.doi.org/10.1007/s12020-018-1723-0
work_keys_str_mv AT daaeelisabeth psychologicaladjustmentqualityoflifeandselfperceptionsofreproductivehealthinmaleswithcongenitaladrenalhyperplasiaasystematicreview
AT feragenkristinbillaud psychologicaladjustmentqualityoflifeandselfperceptionsofreproductivehealthinmaleswithcongenitaladrenalhyperplasiaasystematicreview
AT nermoeningrid psychologicaladjustmentqualityoflifeandselfperceptionsofreproductivehealthinmaleswithcongenitaladrenalhyperplasiaasystematicreview
AT falhammarhenrik psychologicaladjustmentqualityoflifeandselfperceptionsofreproductivehealthinmaleswithcongenitaladrenalhyperplasiaasystematicreview