Cargando…

Self-management of diabetes in Sub-Saharan Africa: a systematic review

BACKGROUND: The prevalence of diabetes in sub-Saharan Africa has increased rapidly over the last years. Self-management is a key element for the proper management, but strategies are currently lacking in this context. This systematic review aims to describe the level of self-management among persons...

Descripción completa

Detalles Bibliográficos
Autores principales: Stephani, Victor, Opoku, Daniel, Beran, David
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6162903/
https://www.ncbi.nlm.nih.gov/pubmed/30268115
http://dx.doi.org/10.1186/s12889-018-6050-0
_version_ 1783359248645750784
author Stephani, Victor
Opoku, Daniel
Beran, David
author_facet Stephani, Victor
Opoku, Daniel
Beran, David
author_sort Stephani, Victor
collection PubMed
description BACKGROUND: The prevalence of diabetes in sub-Saharan Africa has increased rapidly over the last years. Self-management is a key element for the proper management, but strategies are currently lacking in this context. This systematic review aims to describe the level of self-management among persons living with type 2 diabetes mellitus in sub-Saharan Africa. METHOD: Relevant databases including PubMed, Web of Science and Google Scholar were searched up to September 2016. Studies reporting self-management behavior of people with type 2 diabetes mellitus and living in sub-Saharan Africa were included. RESULTS: A total of 550 abstracts and 109 full-text articles were assessed. Forty-three studies, mainly observational, met the inclusion criteria. The studies showed that patients rarely self-monitored their glucose levels, had low frequency/duration of physical activity, moderately adhered to recommended dietary and medication behavior, had poor level of knowledge regarding diabetes related complications and sought traditional or herbal medicines beside of their biomedical treatment. The analysis also revealed a lack of studies on psychosocial aspects. CONCLUSION: Except for the psychosocial area, there is a good amount of recent studies on self-management behavior of type 2 diabetes mellitus sub-Saharan Africa. These studies indicate that self-management in sub-Saharan Africa is poor and therefore a serious threat to the health of individuals and the health systems capacity. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12889-018-6050-0) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6162903
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-61629032018-10-04 Self-management of diabetes in Sub-Saharan Africa: a systematic review Stephani, Victor Opoku, Daniel Beran, David BMC Public Health Research Article BACKGROUND: The prevalence of diabetes in sub-Saharan Africa has increased rapidly over the last years. Self-management is a key element for the proper management, but strategies are currently lacking in this context. This systematic review aims to describe the level of self-management among persons living with type 2 diabetes mellitus in sub-Saharan Africa. METHOD: Relevant databases including PubMed, Web of Science and Google Scholar were searched up to September 2016. Studies reporting self-management behavior of people with type 2 diabetes mellitus and living in sub-Saharan Africa were included. RESULTS: A total of 550 abstracts and 109 full-text articles were assessed. Forty-three studies, mainly observational, met the inclusion criteria. The studies showed that patients rarely self-monitored their glucose levels, had low frequency/duration of physical activity, moderately adhered to recommended dietary and medication behavior, had poor level of knowledge regarding diabetes related complications and sought traditional or herbal medicines beside of their biomedical treatment. The analysis also revealed a lack of studies on psychosocial aspects. CONCLUSION: Except for the psychosocial area, there is a good amount of recent studies on self-management behavior of type 2 diabetes mellitus sub-Saharan Africa. These studies indicate that self-management in sub-Saharan Africa is poor and therefore a serious threat to the health of individuals and the health systems capacity. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12889-018-6050-0) contains supplementary material, which is available to authorized users. BioMed Central 2018-09-29 /pmc/articles/PMC6162903/ /pubmed/30268115 http://dx.doi.org/10.1186/s12889-018-6050-0 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Stephani, Victor
Opoku, Daniel
Beran, David
Self-management of diabetes in Sub-Saharan Africa: a systematic review
title Self-management of diabetes in Sub-Saharan Africa: a systematic review
title_full Self-management of diabetes in Sub-Saharan Africa: a systematic review
title_fullStr Self-management of diabetes in Sub-Saharan Africa: a systematic review
title_full_unstemmed Self-management of diabetes in Sub-Saharan Africa: a systematic review
title_short Self-management of diabetes in Sub-Saharan Africa: a systematic review
title_sort self-management of diabetes in sub-saharan africa: a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6162903/
https://www.ncbi.nlm.nih.gov/pubmed/30268115
http://dx.doi.org/10.1186/s12889-018-6050-0
work_keys_str_mv AT stephanivictor selfmanagementofdiabetesinsubsaharanafricaasystematicreview
AT opokudaniel selfmanagementofdiabetesinsubsaharanafricaasystematicreview
AT berandavid selfmanagementofdiabetesinsubsaharanafricaasystematicreview