Cargando…
Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women
Genome-wide association studies in people with European ancestry suggest that polymorphisms in genes involved in vitamin D (VD) metabolism have an effect on serum concentrations of 25-hydroxyvitamin D. However, nothing is known about these polymorphisms in populations with Amerindian ancestry. Our a...
Autores principales: | , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6164456/ https://www.ncbi.nlm.nih.gov/pubmed/30150596 http://dx.doi.org/10.3390/nu10091175 |
_version_ | 1783359604518813696 |
---|---|
author | Rivera-Paredez, Berenice Macías, Nayeli Martínez-Aguilar, Mayeli M. Hidalgo-Bravo, Alberto Flores, Mario Quezada-Sánchez, Amado D. Denova-Gutiérrez, Edgar Cid, Miguel Martínez-Hernández, Angelica Orozco, Lorena Quiterio, Manuel Flores, Yvonne N. Salmerón, Jorge Velázquez-Cruz, Rafael |
author_facet | Rivera-Paredez, Berenice Macías, Nayeli Martínez-Aguilar, Mayeli M. Hidalgo-Bravo, Alberto Flores, Mario Quezada-Sánchez, Amado D. Denova-Gutiérrez, Edgar Cid, Miguel Martínez-Hernández, Angelica Orozco, Lorena Quiterio, Manuel Flores, Yvonne N. Salmerón, Jorge Velázquez-Cruz, Rafael |
author_sort | Rivera-Paredez, Berenice |
collection | PubMed |
description | Genome-wide association studies in people with European ancestry suggest that polymorphisms in genes involved in vitamin D (VD) metabolism have an effect on serum concentrations of 25-hydroxyvitamin D. However, nothing is known about these polymorphisms in populations with Amerindian ancestry. Our aim was to evaluate the association between genetic variants on the vitamin D receptor (VDR) and the vitamin D binding protein (GC) genes, involved in the VD pathway, and VD deficiency in 689 unrelated Mexican postmenopausal women. We also described the frequencies of these variants in 355 postmenopausal women from different ethnic groups. Based on our preliminary results of 400 unrelated Mexican postmenopausal women, three single nucleotide polymorphisms (SNPs) were selected for genotyping. The SNPs rs4516035 in VDR and rs2282679 in GC were associated with VD deficiency. Additionally, women who carried three risk alleles had a 3.67 times higher risk of suffering VD deficiency, compared to women with no risk alleles (p = 0.002). The rs4516035-C allele frequency in the Amerindian population was enriched in the South East region of Mexico. In contrast, the highest frequency of the rs2298850-C allele, a proxy for the tag SNP rs2282679, was observed in the South region. Our results indicate that genetic variants in VDR and GC genes are associated with VD deficiency in Mexican postmenopausal women. Moreover, an association was observed for the variants rs3794060 and rs4944957 of the DHCR7/NADSYN1 gene with osteopenia/osteoporosis. |
format | Online Article Text |
id | pubmed-6164456 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-61644562018-10-10 Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women Rivera-Paredez, Berenice Macías, Nayeli Martínez-Aguilar, Mayeli M. Hidalgo-Bravo, Alberto Flores, Mario Quezada-Sánchez, Amado D. Denova-Gutiérrez, Edgar Cid, Miguel Martínez-Hernández, Angelica Orozco, Lorena Quiterio, Manuel Flores, Yvonne N. Salmerón, Jorge Velázquez-Cruz, Rafael Nutrients Article Genome-wide association studies in people with European ancestry suggest that polymorphisms in genes involved in vitamin D (VD) metabolism have an effect on serum concentrations of 25-hydroxyvitamin D. However, nothing is known about these polymorphisms in populations with Amerindian ancestry. Our aim was to evaluate the association between genetic variants on the vitamin D receptor (VDR) and the vitamin D binding protein (GC) genes, involved in the VD pathway, and VD deficiency in 689 unrelated Mexican postmenopausal women. We also described the frequencies of these variants in 355 postmenopausal women from different ethnic groups. Based on our preliminary results of 400 unrelated Mexican postmenopausal women, three single nucleotide polymorphisms (SNPs) were selected for genotyping. The SNPs rs4516035 in VDR and rs2282679 in GC were associated with VD deficiency. Additionally, women who carried three risk alleles had a 3.67 times higher risk of suffering VD deficiency, compared to women with no risk alleles (p = 0.002). The rs4516035-C allele frequency in the Amerindian population was enriched in the South East region of Mexico. In contrast, the highest frequency of the rs2298850-C allele, a proxy for the tag SNP rs2282679, was observed in the South region. Our results indicate that genetic variants in VDR and GC genes are associated with VD deficiency in Mexican postmenopausal women. Moreover, an association was observed for the variants rs3794060 and rs4944957 of the DHCR7/NADSYN1 gene with osteopenia/osteoporosis. MDPI 2018-08-27 /pmc/articles/PMC6164456/ /pubmed/30150596 http://dx.doi.org/10.3390/nu10091175 Text en © 2018 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Rivera-Paredez, Berenice Macías, Nayeli Martínez-Aguilar, Mayeli M. Hidalgo-Bravo, Alberto Flores, Mario Quezada-Sánchez, Amado D. Denova-Gutiérrez, Edgar Cid, Miguel Martínez-Hernández, Angelica Orozco, Lorena Quiterio, Manuel Flores, Yvonne N. Salmerón, Jorge Velázquez-Cruz, Rafael Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women |
title | Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women |
title_full | Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women |
title_fullStr | Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women |
title_full_unstemmed | Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women |
title_short | Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women |
title_sort | association between vitamin d deficiency and single nucleotide polymorphisms in the vitamin d receptor and gc genes and analysis of their distribution in mexican postmenopausal women |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6164456/ https://www.ncbi.nlm.nih.gov/pubmed/30150596 http://dx.doi.org/10.3390/nu10091175 |
work_keys_str_mv | AT riveraparedezberenice associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT maciasnayeli associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT martinezaguilarmayelim associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT hidalgobravoalberto associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT floresmario associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT quezadasanchezamadod associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT denovagutierrezedgar associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT cidmiguel associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT martinezhernandezangelica associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT orozcolorena associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT quiteriomanuel associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT floresyvonnen associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT salmeronjorge associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen AT velazquezcruzrafael associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen |