Cargando…

Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women

Genome-wide association studies in people with European ancestry suggest that polymorphisms in genes involved in vitamin D (VD) metabolism have an effect on serum concentrations of 25-hydroxyvitamin D. However, nothing is known about these polymorphisms in populations with Amerindian ancestry. Our a...

Descripción completa

Detalles Bibliográficos
Autores principales: Rivera-Paredez, Berenice, Macías, Nayeli, Martínez-Aguilar, Mayeli M., Hidalgo-Bravo, Alberto, Flores, Mario, Quezada-Sánchez, Amado D., Denova-Gutiérrez, Edgar, Cid, Miguel, Martínez-Hernández, Angelica, Orozco, Lorena, Quiterio, Manuel, Flores, Yvonne N., Salmerón, Jorge, Velázquez-Cruz, Rafael
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6164456/
https://www.ncbi.nlm.nih.gov/pubmed/30150596
http://dx.doi.org/10.3390/nu10091175
_version_ 1783359604518813696
author Rivera-Paredez, Berenice
Macías, Nayeli
Martínez-Aguilar, Mayeli M.
Hidalgo-Bravo, Alberto
Flores, Mario
Quezada-Sánchez, Amado D.
Denova-Gutiérrez, Edgar
Cid, Miguel
Martínez-Hernández, Angelica
Orozco, Lorena
Quiterio, Manuel
Flores, Yvonne N.
Salmerón, Jorge
Velázquez-Cruz, Rafael
author_facet Rivera-Paredez, Berenice
Macías, Nayeli
Martínez-Aguilar, Mayeli M.
Hidalgo-Bravo, Alberto
Flores, Mario
Quezada-Sánchez, Amado D.
Denova-Gutiérrez, Edgar
Cid, Miguel
Martínez-Hernández, Angelica
Orozco, Lorena
Quiterio, Manuel
Flores, Yvonne N.
Salmerón, Jorge
Velázquez-Cruz, Rafael
author_sort Rivera-Paredez, Berenice
collection PubMed
description Genome-wide association studies in people with European ancestry suggest that polymorphisms in genes involved in vitamin D (VD) metabolism have an effect on serum concentrations of 25-hydroxyvitamin D. However, nothing is known about these polymorphisms in populations with Amerindian ancestry. Our aim was to evaluate the association between genetic variants on the vitamin D receptor (VDR) and the vitamin D binding protein (GC) genes, involved in the VD pathway, and VD deficiency in 689 unrelated Mexican postmenopausal women. We also described the frequencies of these variants in 355 postmenopausal women from different ethnic groups. Based on our preliminary results of 400 unrelated Mexican postmenopausal women, three single nucleotide polymorphisms (SNPs) were selected for genotyping. The SNPs rs4516035 in VDR and rs2282679 in GC were associated with VD deficiency. Additionally, women who carried three risk alleles had a 3.67 times higher risk of suffering VD deficiency, compared to women with no risk alleles (p = 0.002). The rs4516035-C allele frequency in the Amerindian population was enriched in the South East region of Mexico. In contrast, the highest frequency of the rs2298850-C allele, a proxy for the tag SNP rs2282679, was observed in the South region. Our results indicate that genetic variants in VDR and GC genes are associated with VD deficiency in Mexican postmenopausal women. Moreover, an association was observed for the variants rs3794060 and rs4944957 of the DHCR7/NADSYN1 gene with osteopenia/osteoporosis.
format Online
Article
Text
id pubmed-6164456
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-61644562018-10-10 Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women Rivera-Paredez, Berenice Macías, Nayeli Martínez-Aguilar, Mayeli M. Hidalgo-Bravo, Alberto Flores, Mario Quezada-Sánchez, Amado D. Denova-Gutiérrez, Edgar Cid, Miguel Martínez-Hernández, Angelica Orozco, Lorena Quiterio, Manuel Flores, Yvonne N. Salmerón, Jorge Velázquez-Cruz, Rafael Nutrients Article Genome-wide association studies in people with European ancestry suggest that polymorphisms in genes involved in vitamin D (VD) metabolism have an effect on serum concentrations of 25-hydroxyvitamin D. However, nothing is known about these polymorphisms in populations with Amerindian ancestry. Our aim was to evaluate the association between genetic variants on the vitamin D receptor (VDR) and the vitamin D binding protein (GC) genes, involved in the VD pathway, and VD deficiency in 689 unrelated Mexican postmenopausal women. We also described the frequencies of these variants in 355 postmenopausal women from different ethnic groups. Based on our preliminary results of 400 unrelated Mexican postmenopausal women, three single nucleotide polymorphisms (SNPs) were selected for genotyping. The SNPs rs4516035 in VDR and rs2282679 in GC were associated with VD deficiency. Additionally, women who carried three risk alleles had a 3.67 times higher risk of suffering VD deficiency, compared to women with no risk alleles (p = 0.002). The rs4516035-C allele frequency in the Amerindian population was enriched in the South East region of Mexico. In contrast, the highest frequency of the rs2298850-C allele, a proxy for the tag SNP rs2282679, was observed in the South region. Our results indicate that genetic variants in VDR and GC genes are associated with VD deficiency in Mexican postmenopausal women. Moreover, an association was observed for the variants rs3794060 and rs4944957 of the DHCR7/NADSYN1 gene with osteopenia/osteoporosis. MDPI 2018-08-27 /pmc/articles/PMC6164456/ /pubmed/30150596 http://dx.doi.org/10.3390/nu10091175 Text en © 2018 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Rivera-Paredez, Berenice
Macías, Nayeli
Martínez-Aguilar, Mayeli M.
Hidalgo-Bravo, Alberto
Flores, Mario
Quezada-Sánchez, Amado D.
Denova-Gutiérrez, Edgar
Cid, Miguel
Martínez-Hernández, Angelica
Orozco, Lorena
Quiterio, Manuel
Flores, Yvonne N.
Salmerón, Jorge
Velázquez-Cruz, Rafael
Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women
title Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women
title_full Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women
title_fullStr Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women
title_full_unstemmed Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women
title_short Association between Vitamin D Deficiency and Single Nucleotide Polymorphisms in the Vitamin D Receptor and GC Genes and Analysis of Their Distribution in Mexican Postmenopausal Women
title_sort association between vitamin d deficiency and single nucleotide polymorphisms in the vitamin d receptor and gc genes and analysis of their distribution in mexican postmenopausal women
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6164456/
https://www.ncbi.nlm.nih.gov/pubmed/30150596
http://dx.doi.org/10.3390/nu10091175
work_keys_str_mv AT riveraparedezberenice associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT maciasnayeli associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT martinezaguilarmayelim associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT hidalgobravoalberto associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT floresmario associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT quezadasanchezamadod associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT denovagutierrezedgar associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT cidmiguel associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT martinezhernandezangelica associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT orozcolorena associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT quiteriomanuel associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT floresyvonnen associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT salmeronjorge associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen
AT velazquezcruzrafael associationbetweenvitaminddeficiencyandsinglenucleotidepolymorphismsinthevitamindreceptorandgcgenesandanalysisoftheirdistributioninmexicanpostmenopausalwomen