Cargando…
A descriptive analysis of non-Cochrane child-relevant systematic reviews published in 2014
BACKGROUND: Consumers, clinicians, policymakers and researchers require high quality evidence to guide decision-making in child health. Though Cochrane systematic reviews (SRs) are a well-established source of evidence, little is known about the characteristics of non-Cochrane child-relevant SRs. To...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6167827/ https://www.ncbi.nlm.nih.gov/pubmed/30285643 http://dx.doi.org/10.1186/s12874-018-0562-2 |
_version_ | 1783360267413880832 |
---|---|
author | Gates, Michelle Elliott, Sarah A Johnson, Cydney Thomson, Denise Williams, Katrina Fernandes, Ricardo M Hartling, Lisa |
author_facet | Gates, Michelle Elliott, Sarah A Johnson, Cydney Thomson, Denise Williams, Katrina Fernandes, Ricardo M Hartling, Lisa |
author_sort | Gates, Michelle |
collection | PubMed |
description | BACKGROUND: Consumers, clinicians, policymakers and researchers require high quality evidence to guide decision-making in child health. Though Cochrane systematic reviews (SRs) are a well-established source of evidence, little is known about the characteristics of non-Cochrane child-relevant SRs. To complement published descriptions of Cochrane SRs, we aimed to characterize the epidemiologic, methodological, and reporting qualities of non-Cochrane child-relevant SRs published in 2014. METHODS: English-language child-relevant SRs of quantitative primary research published outside the Cochrane Library in 2014 were eligible for this descriptive analysis. A research librarian searched MEDLINE, CINAHL, Web of Science, and PubMed in August 2015. A single reviewer screened articles for inclusion; a second verified the excluded studies. Reviewers extracted: general characteristics of the review; included study characteristics; methodological approaches. We performed univariate analyses and presented the findings narratively. RESULTS: We identified 1598 child-relevant SRs containing a median (IQR) 19 (11, 33) studies. These originated primarily from high-income countries (n = 1247, 78.0%) and spanned 47 of the 53 Cochrane Review Groups. Most synthesized therapeutic (n = 753, 47.1%) or epidemiologic (n = 701, 43.8%) evidence. Though 39.3% (n = 628) of SRs included evidence related to children only, few were published in pediatric-specific journals (n = 283, 17.7%). Reporting quality seemed poor based on the items we assessed; few reviews mentioned an a-priori protocol (n = 246, 15.4%) or registration (n = 111, 6.9%), and only 23.4% (n = 374) specified a primary outcome. Many SRs relied solely on evidence from non-RCTs (n = 796, 49.8%). Less than two-thirds (n = 953, 59.6%) appraised the quality of included studies and assessments of the certainty of the body of evidence were rare (n = 102, 6.4%). CONCLUSIONS: Child-relevant Cochrane SRs are a known source of high quality evidence in pediatrics. There exists, however, an abundance of evidence from non-Cochrane SRs that may be complementary. Our findings show that high-quality non-Cochrane SRs may not be practical nor easy for knowledge users to find. Improvements are needed to ensure that evidence syntheses published outside of the Cochrane Library adhere to the high standard of conduct and reporting characteristic of Cochrane SRs. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12874-018-0562-2) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6167827 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-61678272018-10-09 A descriptive analysis of non-Cochrane child-relevant systematic reviews published in 2014 Gates, Michelle Elliott, Sarah A Johnson, Cydney Thomson, Denise Williams, Katrina Fernandes, Ricardo M Hartling, Lisa BMC Med Res Methodol Research Article BACKGROUND: Consumers, clinicians, policymakers and researchers require high quality evidence to guide decision-making in child health. Though Cochrane systematic reviews (SRs) are a well-established source of evidence, little is known about the characteristics of non-Cochrane child-relevant SRs. To complement published descriptions of Cochrane SRs, we aimed to characterize the epidemiologic, methodological, and reporting qualities of non-Cochrane child-relevant SRs published in 2014. METHODS: English-language child-relevant SRs of quantitative primary research published outside the Cochrane Library in 2014 were eligible for this descriptive analysis. A research librarian searched MEDLINE, CINAHL, Web of Science, and PubMed in August 2015. A single reviewer screened articles for inclusion; a second verified the excluded studies. Reviewers extracted: general characteristics of the review; included study characteristics; methodological approaches. We performed univariate analyses and presented the findings narratively. RESULTS: We identified 1598 child-relevant SRs containing a median (IQR) 19 (11, 33) studies. These originated primarily from high-income countries (n = 1247, 78.0%) and spanned 47 of the 53 Cochrane Review Groups. Most synthesized therapeutic (n = 753, 47.1%) or epidemiologic (n = 701, 43.8%) evidence. Though 39.3% (n = 628) of SRs included evidence related to children only, few were published in pediatric-specific journals (n = 283, 17.7%). Reporting quality seemed poor based on the items we assessed; few reviews mentioned an a-priori protocol (n = 246, 15.4%) or registration (n = 111, 6.9%), and only 23.4% (n = 374) specified a primary outcome. Many SRs relied solely on evidence from non-RCTs (n = 796, 49.8%). Less than two-thirds (n = 953, 59.6%) appraised the quality of included studies and assessments of the certainty of the body of evidence were rare (n = 102, 6.4%). CONCLUSIONS: Child-relevant Cochrane SRs are a known source of high quality evidence in pediatrics. There exists, however, an abundance of evidence from non-Cochrane SRs that may be complementary. Our findings show that high-quality non-Cochrane SRs may not be practical nor easy for knowledge users to find. Improvements are needed to ensure that evidence syntheses published outside of the Cochrane Library adhere to the high standard of conduct and reporting characteristic of Cochrane SRs. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12874-018-0562-2) contains supplementary material, which is available to authorized users. BioMed Central 2018-10-01 /pmc/articles/PMC6167827/ /pubmed/30285643 http://dx.doi.org/10.1186/s12874-018-0562-2 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Gates, Michelle Elliott, Sarah A Johnson, Cydney Thomson, Denise Williams, Katrina Fernandes, Ricardo M Hartling, Lisa A descriptive analysis of non-Cochrane child-relevant systematic reviews published in 2014 |
title | A descriptive analysis of non-Cochrane child-relevant systematic reviews published in 2014 |
title_full | A descriptive analysis of non-Cochrane child-relevant systematic reviews published in 2014 |
title_fullStr | A descriptive analysis of non-Cochrane child-relevant systematic reviews published in 2014 |
title_full_unstemmed | A descriptive analysis of non-Cochrane child-relevant systematic reviews published in 2014 |
title_short | A descriptive analysis of non-Cochrane child-relevant systematic reviews published in 2014 |
title_sort | descriptive analysis of non-cochrane child-relevant systematic reviews published in 2014 |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6167827/ https://www.ncbi.nlm.nih.gov/pubmed/30285643 http://dx.doi.org/10.1186/s12874-018-0562-2 |
work_keys_str_mv | AT gatesmichelle adescriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT elliottsaraha adescriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT johnsoncydney adescriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT thomsondenise adescriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT williamskatrina adescriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT fernandesricardom adescriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT hartlinglisa adescriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT gatesmichelle descriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT elliottsaraha descriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT johnsoncydney descriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT thomsondenise descriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT williamskatrina descriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT fernandesricardom descriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 AT hartlinglisa descriptiveanalysisofnoncochranechildrelevantsystematicreviewspublishedin2014 |