Cargando…
D-dimer plasmatic levels as a marker for diagnosis and prognosis of hepatocellular carcinoma patients with portal vein thrombosis
PURPOSE: Portal vein thrombosis (PVT) is one of the severe complications of hepatocellular carcinoma (HCC). PVT deteriorates the liver, and its dysfunction increases the risk of bleeding, influencing the prognosis of patients with liver cirrhosis and HCC. The aim of our study was to investigate whet...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Dove Medical Press
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6174900/ https://www.ncbi.nlm.nih.gov/pubmed/30323642 http://dx.doi.org/10.2147/CEG.S172663 |
_version_ | 1783361371761541120 |
---|---|
author | Malaguarnera, Michele Latteri, Saverio Bertino, Gaetano Madeddu, Roberto Catania, Vito Emanuele Currò, Giuseppe Borzì, Antonio Maria Drago, Filippo Malaguarnera, Giulia |
author_facet | Malaguarnera, Michele Latteri, Saverio Bertino, Gaetano Madeddu, Roberto Catania, Vito Emanuele Currò, Giuseppe Borzì, Antonio Maria Drago, Filippo Malaguarnera, Giulia |
author_sort | Malaguarnera, Michele |
collection | PubMed |
description | PURPOSE: Portal vein thrombosis (PVT) is one of the severe complications of hepatocellular carcinoma (HCC). PVT deteriorates the liver, and its dysfunction increases the risk of bleeding, influencing the prognosis of patients with liver cirrhosis and HCC. The aim of our study was to investigate whether D-dimer testing could be a sensitive marker for the diagnosis and prognosis of HCC patients with PVT. PATIENTS AND METHODS: Between June 2010 and December 2015, 118 HCC patients were admitted to Cannizzaro Hospital, Catania, and 50 controls were recruited from their relatives for health examinations. All enrolled patients were diagnosed and pathologically confirmed as having HCC. D-dimer was measured with an enzyme-linked immunosorbent assay using 2 monoclonal antibodies against nonoverlapping determinants of D-dimer. RESULTS: D-dimer levels in HCC patients with PVT were significantly higher vs HCC patients without PVT, P<0.002, and vs controls, P<0.001. CONCLUSION: Plasma D-dimer is a sensitive marker of fibrin turnover and allows for the recognition of activated coagulation which may be manifested in HCC with PVT. |
format | Online Article Text |
id | pubmed-6174900 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Dove Medical Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-61749002018-10-15 D-dimer plasmatic levels as a marker for diagnosis and prognosis of hepatocellular carcinoma patients with portal vein thrombosis Malaguarnera, Michele Latteri, Saverio Bertino, Gaetano Madeddu, Roberto Catania, Vito Emanuele Currò, Giuseppe Borzì, Antonio Maria Drago, Filippo Malaguarnera, Giulia Clin Exp Gastroenterol Original Research PURPOSE: Portal vein thrombosis (PVT) is one of the severe complications of hepatocellular carcinoma (HCC). PVT deteriorates the liver, and its dysfunction increases the risk of bleeding, influencing the prognosis of patients with liver cirrhosis and HCC. The aim of our study was to investigate whether D-dimer testing could be a sensitive marker for the diagnosis and prognosis of HCC patients with PVT. PATIENTS AND METHODS: Between June 2010 and December 2015, 118 HCC patients were admitted to Cannizzaro Hospital, Catania, and 50 controls were recruited from their relatives for health examinations. All enrolled patients were diagnosed and pathologically confirmed as having HCC. D-dimer was measured with an enzyme-linked immunosorbent assay using 2 monoclonal antibodies against nonoverlapping determinants of D-dimer. RESULTS: D-dimer levels in HCC patients with PVT were significantly higher vs HCC patients without PVT, P<0.002, and vs controls, P<0.001. CONCLUSION: Plasma D-dimer is a sensitive marker of fibrin turnover and allows for the recognition of activated coagulation which may be manifested in HCC with PVT. Dove Medical Press 2018-10-03 /pmc/articles/PMC6174900/ /pubmed/30323642 http://dx.doi.org/10.2147/CEG.S172663 Text en © 2018 Malaguarnera et al. This work is published and licensed by Dove Medical Press Limited The full terms of this license are available at https://www.dovepress.com/terms.php and incorporate the Creative Commons Attribution – Non Commercial (unported, v3.0) License (http://creativecommons.org/licenses/by-nc/3.0/). By accessing the work you hereby accept the Terms. Non-commercial uses of the work are permitted without any further permission from Dove Medical Press Limited, provided the work is properly attributed. |
spellingShingle | Original Research Malaguarnera, Michele Latteri, Saverio Bertino, Gaetano Madeddu, Roberto Catania, Vito Emanuele Currò, Giuseppe Borzì, Antonio Maria Drago, Filippo Malaguarnera, Giulia D-dimer plasmatic levels as a marker for diagnosis and prognosis of hepatocellular carcinoma patients with portal vein thrombosis |
title | D-dimer plasmatic levels as a marker for diagnosis and prognosis of hepatocellular carcinoma patients with portal vein thrombosis |
title_full | D-dimer plasmatic levels as a marker for diagnosis and prognosis of hepatocellular carcinoma patients with portal vein thrombosis |
title_fullStr | D-dimer plasmatic levels as a marker for diagnosis and prognosis of hepatocellular carcinoma patients with portal vein thrombosis |
title_full_unstemmed | D-dimer plasmatic levels as a marker for diagnosis and prognosis of hepatocellular carcinoma patients with portal vein thrombosis |
title_short | D-dimer plasmatic levels as a marker for diagnosis and prognosis of hepatocellular carcinoma patients with portal vein thrombosis |
title_sort | d-dimer plasmatic levels as a marker for diagnosis and prognosis of hepatocellular carcinoma patients with portal vein thrombosis |
topic | Original Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6174900/ https://www.ncbi.nlm.nih.gov/pubmed/30323642 http://dx.doi.org/10.2147/CEG.S172663 |
work_keys_str_mv | AT malaguarneramichele ddimerplasmaticlevelsasamarkerfordiagnosisandprognosisofhepatocellularcarcinomapatientswithportalveinthrombosis AT latterisaverio ddimerplasmaticlevelsasamarkerfordiagnosisandprognosisofhepatocellularcarcinomapatientswithportalveinthrombosis AT bertinogaetano ddimerplasmaticlevelsasamarkerfordiagnosisandprognosisofhepatocellularcarcinomapatientswithportalveinthrombosis AT madedduroberto ddimerplasmaticlevelsasamarkerfordiagnosisandprognosisofhepatocellularcarcinomapatientswithportalveinthrombosis AT cataniavitoemanuele ddimerplasmaticlevelsasamarkerfordiagnosisandprognosisofhepatocellularcarcinomapatientswithportalveinthrombosis AT currogiuseppe ddimerplasmaticlevelsasamarkerfordiagnosisandprognosisofhepatocellularcarcinomapatientswithportalveinthrombosis AT borziantoniomaria ddimerplasmaticlevelsasamarkerfordiagnosisandprognosisofhepatocellularcarcinomapatientswithportalveinthrombosis AT dragofilippo ddimerplasmaticlevelsasamarkerfordiagnosisandprognosisofhepatocellularcarcinomapatientswithportalveinthrombosis AT malaguarneragiulia ddimerplasmaticlevelsasamarkerfordiagnosisandprognosisofhepatocellularcarcinomapatientswithportalveinthrombosis |