Cargando…

Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation

Chronic Myeloid Leukemia (CML) is a clonal myeloproliferative neoplasm (MPN) characterized by the presence of a reciprocal translocation between the long arms of chromosomes 9 and 22, t(9;22)(q34:q11), resulting in fusion of the break point cluster region (BCR) with the ABL gene, which forms an onco...

Descripción completa

Detalles Bibliográficos
Autores principales: Soliman, Dina S, Amer, Aliaa M, Mudawi, Deena, Nawaz, Zafar, Alkuwari, Einas, Al Sabbagh, Ahmad, Ibrahim, Feryal, Yassin, Mohamed A
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Mattioli 1885 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6179102/
https://www.ncbi.nlm.nih.gov/pubmed/29633732
http://dx.doi.org/10.23750/abm.v89i3-S.7219
_version_ 1783362046114398208
author Soliman, Dina S
Amer, Aliaa M
Mudawi, Deena
Nawaz, Zafar
Alkuwari, Einas
Al Sabbagh, Ahmad
Ibrahim, Feryal
Yassin, Mohamed A
author_facet Soliman, Dina S
Amer, Aliaa M
Mudawi, Deena
Nawaz, Zafar
Alkuwari, Einas
Al Sabbagh, Ahmad
Ibrahim, Feryal
Yassin, Mohamed A
author_sort Soliman, Dina S
collection PubMed
description Chronic Myeloid Leukemia (CML) is a clonal myeloproliferative neoplasm (MPN) characterized by the presence of a reciprocal translocation between the long arms of chromosomes 9 and 22, t(9;22)(q34:q11), resulting in fusion of the break point cluster region (BCR) with the ABL gene, which forms an oncogene, the transcript of which is an oncoprotein with a tyrosine kinase function. In the great majority of CML; BCR/ABL1 is cytogenetically visualized as t(9;22); giving rise to the Ph chromosome, harboring the chimeric gene. Cryptic or masked translocations occur in 2-10% patients with no evidence for the BCR/ABL rearrangement by conventional cytogenetics but are positive by Fluorescence in Situ Hybridization (FISH) and/or reverse transcriptase polymerase chain reaction (RT-PCR). These patients are described as Philadelphia negative (Ph negative) BCR/ABL1-positive CML with the chimeric gene present on the derivative chromosome 22, as in most CML cases, or alternatively on the derivative 9 in rare occasions. In the majority of cases, CML is diagnosed in the chronic phase; it is less frequently diagnosed in accelerated crises, and occasionally, its initial presentation is as acute leukemia. The prevalence of extramedullary blast phase (BP) has been reported to be 7-17% in patients with BP. Surprisingly, no extramedullary blast crises of B-lymphoid lineage have been reported before among cases of CML as the initial presentation. We report an adult male diagnosed as CML-chronic phase when he was shortly presented with treatment-naive extramedullary B-lymphoid blast crises involving multiple lymph nodes, with no features of acceleration or blast crises in the peripheral blood (PB) and bone marrow (BM). In addition the patient had variant/cryptic Philadelphia translocation. This is the first report of CML, on the best of our knowledge, with extramedullary B-lymphoid blast phase, as initial presentation, that showed a cryptic Ph translocation. (www.actabiomedica.it)
format Online
Article
Text
id pubmed-6179102
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Mattioli 1885
record_format MEDLINE/PubMed
spelling pubmed-61791022019-05-08 Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation Soliman, Dina S Amer, Aliaa M Mudawi, Deena Nawaz, Zafar Alkuwari, Einas Al Sabbagh, Ahmad Ibrahim, Feryal Yassin, Mohamed A Acta Biomed Case Report Chronic Myeloid Leukemia (CML) is a clonal myeloproliferative neoplasm (MPN) characterized by the presence of a reciprocal translocation between the long arms of chromosomes 9 and 22, t(9;22)(q34:q11), resulting in fusion of the break point cluster region (BCR) with the ABL gene, which forms an oncogene, the transcript of which is an oncoprotein with a tyrosine kinase function. In the great majority of CML; BCR/ABL1 is cytogenetically visualized as t(9;22); giving rise to the Ph chromosome, harboring the chimeric gene. Cryptic or masked translocations occur in 2-10% patients with no evidence for the BCR/ABL rearrangement by conventional cytogenetics but are positive by Fluorescence in Situ Hybridization (FISH) and/or reverse transcriptase polymerase chain reaction (RT-PCR). These patients are described as Philadelphia negative (Ph negative) BCR/ABL1-positive CML with the chimeric gene present on the derivative chromosome 22, as in most CML cases, or alternatively on the derivative 9 in rare occasions. In the majority of cases, CML is diagnosed in the chronic phase; it is less frequently diagnosed in accelerated crises, and occasionally, its initial presentation is as acute leukemia. The prevalence of extramedullary blast phase (BP) has been reported to be 7-17% in patients with BP. Surprisingly, no extramedullary blast crises of B-lymphoid lineage have been reported before among cases of CML as the initial presentation. We report an adult male diagnosed as CML-chronic phase when he was shortly presented with treatment-naive extramedullary B-lymphoid blast crises involving multiple lymph nodes, with no features of acceleration or blast crises in the peripheral blood (PB) and bone marrow (BM). In addition the patient had variant/cryptic Philadelphia translocation. This is the first report of CML, on the best of our knowledge, with extramedullary B-lymphoid blast phase, as initial presentation, that showed a cryptic Ph translocation. (www.actabiomedica.it) Mattioli 1885 2018 /pmc/articles/PMC6179102/ /pubmed/29633732 http://dx.doi.org/10.23750/abm.v89i3-S.7219 Text en Copyright: © 2018 ACTA BIO MEDICA SOCIETY OF MEDICINE AND NATURAL SCIENCES OF PARMA http://creativecommons.org/licenses/by-nc-sa/4.0 This work is licensed under a Creative Commons Attribution 4.0 International License
spellingShingle Case Report
Soliman, Dina S
Amer, Aliaa M
Mudawi, Deena
Nawaz, Zafar
Alkuwari, Einas
Al Sabbagh, Ahmad
Ibrahim, Feryal
Yassin, Mohamed A
Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation
title Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation
title_full Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation
title_fullStr Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation
title_full_unstemmed Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation
title_short Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation
title_sort chronic myeloid leukemia with cryptic philadelphia translocation and extramedullary b-lymphoid blast phase as an initial presentation
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6179102/
https://www.ncbi.nlm.nih.gov/pubmed/29633732
http://dx.doi.org/10.23750/abm.v89i3-S.7219
work_keys_str_mv AT solimandinas chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation
AT ameraliaam chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation
AT mudawideena chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation
AT nawazzafar chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation
AT alkuwarieinas chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation
AT alsabbaghahmad chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation
AT ibrahimferyal chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation
AT yassinmohameda chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation