Cargando…
Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation
Chronic Myeloid Leukemia (CML) is a clonal myeloproliferative neoplasm (MPN) characterized by the presence of a reciprocal translocation between the long arms of chromosomes 9 and 22, t(9;22)(q34:q11), resulting in fusion of the break point cluster region (BCR) with the ABL gene, which forms an onco...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Mattioli 1885
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6179102/ https://www.ncbi.nlm.nih.gov/pubmed/29633732 http://dx.doi.org/10.23750/abm.v89i3-S.7219 |
_version_ | 1783362046114398208 |
---|---|
author | Soliman, Dina S Amer, Aliaa M Mudawi, Deena Nawaz, Zafar Alkuwari, Einas Al Sabbagh, Ahmad Ibrahim, Feryal Yassin, Mohamed A |
author_facet | Soliman, Dina S Amer, Aliaa M Mudawi, Deena Nawaz, Zafar Alkuwari, Einas Al Sabbagh, Ahmad Ibrahim, Feryal Yassin, Mohamed A |
author_sort | Soliman, Dina S |
collection | PubMed |
description | Chronic Myeloid Leukemia (CML) is a clonal myeloproliferative neoplasm (MPN) characterized by the presence of a reciprocal translocation between the long arms of chromosomes 9 and 22, t(9;22)(q34:q11), resulting in fusion of the break point cluster region (BCR) with the ABL gene, which forms an oncogene, the transcript of which is an oncoprotein with a tyrosine kinase function. In the great majority of CML; BCR/ABL1 is cytogenetically visualized as t(9;22); giving rise to the Ph chromosome, harboring the chimeric gene. Cryptic or masked translocations occur in 2-10% patients with no evidence for the BCR/ABL rearrangement by conventional cytogenetics but are positive by Fluorescence in Situ Hybridization (FISH) and/or reverse transcriptase polymerase chain reaction (RT-PCR). These patients are described as Philadelphia negative (Ph negative) BCR/ABL1-positive CML with the chimeric gene present on the derivative chromosome 22, as in most CML cases, or alternatively on the derivative 9 in rare occasions. In the majority of cases, CML is diagnosed in the chronic phase; it is less frequently diagnosed in accelerated crises, and occasionally, its initial presentation is as acute leukemia. The prevalence of extramedullary blast phase (BP) has been reported to be 7-17% in patients with BP. Surprisingly, no extramedullary blast crises of B-lymphoid lineage have been reported before among cases of CML as the initial presentation. We report an adult male diagnosed as CML-chronic phase when he was shortly presented with treatment-naive extramedullary B-lymphoid blast crises involving multiple lymph nodes, with no features of acceleration or blast crises in the peripheral blood (PB) and bone marrow (BM). In addition the patient had variant/cryptic Philadelphia translocation. This is the first report of CML, on the best of our knowledge, with extramedullary B-lymphoid blast phase, as initial presentation, that showed a cryptic Ph translocation. (www.actabiomedica.it) |
format | Online Article Text |
id | pubmed-6179102 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Mattioli 1885 |
record_format | MEDLINE/PubMed |
spelling | pubmed-61791022019-05-08 Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation Soliman, Dina S Amer, Aliaa M Mudawi, Deena Nawaz, Zafar Alkuwari, Einas Al Sabbagh, Ahmad Ibrahim, Feryal Yassin, Mohamed A Acta Biomed Case Report Chronic Myeloid Leukemia (CML) is a clonal myeloproliferative neoplasm (MPN) characterized by the presence of a reciprocal translocation between the long arms of chromosomes 9 and 22, t(9;22)(q34:q11), resulting in fusion of the break point cluster region (BCR) with the ABL gene, which forms an oncogene, the transcript of which is an oncoprotein with a tyrosine kinase function. In the great majority of CML; BCR/ABL1 is cytogenetically visualized as t(9;22); giving rise to the Ph chromosome, harboring the chimeric gene. Cryptic or masked translocations occur in 2-10% patients with no evidence for the BCR/ABL rearrangement by conventional cytogenetics but are positive by Fluorescence in Situ Hybridization (FISH) and/or reverse transcriptase polymerase chain reaction (RT-PCR). These patients are described as Philadelphia negative (Ph negative) BCR/ABL1-positive CML with the chimeric gene present on the derivative chromosome 22, as in most CML cases, or alternatively on the derivative 9 in rare occasions. In the majority of cases, CML is diagnosed in the chronic phase; it is less frequently diagnosed in accelerated crises, and occasionally, its initial presentation is as acute leukemia. The prevalence of extramedullary blast phase (BP) has been reported to be 7-17% in patients with BP. Surprisingly, no extramedullary blast crises of B-lymphoid lineage have been reported before among cases of CML as the initial presentation. We report an adult male diagnosed as CML-chronic phase when he was shortly presented with treatment-naive extramedullary B-lymphoid blast crises involving multiple lymph nodes, with no features of acceleration or blast crises in the peripheral blood (PB) and bone marrow (BM). In addition the patient had variant/cryptic Philadelphia translocation. This is the first report of CML, on the best of our knowledge, with extramedullary B-lymphoid blast phase, as initial presentation, that showed a cryptic Ph translocation. (www.actabiomedica.it) Mattioli 1885 2018 /pmc/articles/PMC6179102/ /pubmed/29633732 http://dx.doi.org/10.23750/abm.v89i3-S.7219 Text en Copyright: © 2018 ACTA BIO MEDICA SOCIETY OF MEDICINE AND NATURAL SCIENCES OF PARMA http://creativecommons.org/licenses/by-nc-sa/4.0 This work is licensed under a Creative Commons Attribution 4.0 International License |
spellingShingle | Case Report Soliman, Dina S Amer, Aliaa M Mudawi, Deena Nawaz, Zafar Alkuwari, Einas Al Sabbagh, Ahmad Ibrahim, Feryal Yassin, Mohamed A Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation |
title | Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation |
title_full | Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation |
title_fullStr | Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation |
title_full_unstemmed | Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation |
title_short | Chronic Myeloid Leukemia with cryptic Philadelphia translocation and extramedullary B-lymphoid blast phase as an initial presentation |
title_sort | chronic myeloid leukemia with cryptic philadelphia translocation and extramedullary b-lymphoid blast phase as an initial presentation |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6179102/ https://www.ncbi.nlm.nih.gov/pubmed/29633732 http://dx.doi.org/10.23750/abm.v89i3-S.7219 |
work_keys_str_mv | AT solimandinas chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation AT ameraliaam chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation AT mudawideena chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation AT nawazzafar chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation AT alkuwarieinas chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation AT alsabbaghahmad chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation AT ibrahimferyal chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation AT yassinmohameda chronicmyeloidleukemiawithcrypticphiladelphiatranslocationandextramedullaryblymphoidblastphaseasaninitialpresentation |