Cargando…

AB097. The expression of kallikrein-kinin system in penile tissue of ED rat model

BACKGROUND: To study the expression of kallikrein-kinin system in rats with impotence syndrome and discussion on its biological significance. METHODS: One hundred and twenty male Sprague-Dawley (SD) rats with normal sexual function: 20 normal control group, and 100 rats were selected as model group....

Descripción completa

Detalles Bibliográficos
Autores principales: Amuti, Siyiti, Tianyu, Wang, Wenjing, Ma, Wenjuan, Liu, Yiming, Adilijiang
Formato: Online Artículo Texto
Lenguaje:English
Publicado: AME Publishing Company 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6186740/
http://dx.doi.org/10.21037/tau.2018.AB097
_version_ 1783362893306134528
author Amuti, Siyiti
Tianyu, Wang
Wenjing, Ma
Wenjuan, Liu
Yiming, Adilijiang
author_facet Amuti, Siyiti
Tianyu, Wang
Wenjing, Ma
Wenjuan, Liu
Yiming, Adilijiang
author_sort Amuti, Siyiti
collection PubMed
description BACKGROUND: To study the expression of kallikrein-kinin system in rats with impotence syndrome and discussion on its biological significance. METHODS: One hundred and twenty male Sprague-Dawley (SD) rats with normal sexual function: 20 normal control group, and 100 rats were selected as model group. The erectile dysfunction (ED) rat model was made using the composite factors, and the rats of the ED model were determined by mating experiments and apomor-phine-induced (APO) erection experiments and randomly divided into ED model group (ED group) and drug treatment group (Y group). The drug group was treated with 250 mg/kg of Yimusake for 2 weeks, were used reverse transcriptase polymerase chain reaction (RT-PCR), Western-blot and immunohistochemical detection of rat tissue kallikrein1, T-kininogen mRNA and protein expression levels in penile. RESULTS: The model group of kallikrein1 was decreased compared with the normal group and the drug group, and the T-kininogen model group was increased compared with the normal group and the drug group (P<0.05). CONCLUSIONS: (I) The kallikrein-kinin system changes involved in the occurrence and development of ED, and may play an important role in the mechanism; (II) Yimusake for the treatment of ED associated with the regulation of kallikrein-kinin system.
format Online
Article
Text
id pubmed-6186740
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher AME Publishing Company
record_format MEDLINE/PubMed
spelling pubmed-61867402018-10-26 AB097. The expression of kallikrein-kinin system in penile tissue of ED rat model Amuti, Siyiti Tianyu, Wang Wenjing, Ma Wenjuan, Liu Yiming, Adilijiang Transl Androl Urol Printed Abstract BACKGROUND: To study the expression of kallikrein-kinin system in rats with impotence syndrome and discussion on its biological significance. METHODS: One hundred and twenty male Sprague-Dawley (SD) rats with normal sexual function: 20 normal control group, and 100 rats were selected as model group. The erectile dysfunction (ED) rat model was made using the composite factors, and the rats of the ED model were determined by mating experiments and apomor-phine-induced (APO) erection experiments and randomly divided into ED model group (ED group) and drug treatment group (Y group). The drug group was treated with 250 mg/kg of Yimusake for 2 weeks, were used reverse transcriptase polymerase chain reaction (RT-PCR), Western-blot and immunohistochemical detection of rat tissue kallikrein1, T-kininogen mRNA and protein expression levels in penile. RESULTS: The model group of kallikrein1 was decreased compared with the normal group and the drug group, and the T-kininogen model group was increased compared with the normal group and the drug group (P<0.05). CONCLUSIONS: (I) The kallikrein-kinin system changes involved in the occurrence and development of ED, and may play an important role in the mechanism; (II) Yimusake for the treatment of ED associated with the regulation of kallikrein-kinin system. AME Publishing Company 2018-09 /pmc/articles/PMC6186740/ http://dx.doi.org/10.21037/tau.2018.AB097 Text en 2018 Translational Andrology and Urology. All rights reserved.
spellingShingle Printed Abstract
Amuti, Siyiti
Tianyu, Wang
Wenjing, Ma
Wenjuan, Liu
Yiming, Adilijiang
AB097. The expression of kallikrein-kinin system in penile tissue of ED rat model
title AB097. The expression of kallikrein-kinin system in penile tissue of ED rat model
title_full AB097. The expression of kallikrein-kinin system in penile tissue of ED rat model
title_fullStr AB097. The expression of kallikrein-kinin system in penile tissue of ED rat model
title_full_unstemmed AB097. The expression of kallikrein-kinin system in penile tissue of ED rat model
title_short AB097. The expression of kallikrein-kinin system in penile tissue of ED rat model
title_sort ab097. the expression of kallikrein-kinin system in penile tissue of ed rat model
topic Printed Abstract
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6186740/
http://dx.doi.org/10.21037/tau.2018.AB097
work_keys_str_mv AT amutisiyiti ab097theexpressionofkallikreinkininsysteminpeniletissueofedratmodel
AT tianyuwang ab097theexpressionofkallikreinkininsysteminpeniletissueofedratmodel
AT wenjingma ab097theexpressionofkallikreinkininsysteminpeniletissueofedratmodel
AT wenjuanliu ab097theexpressionofkallikreinkininsysteminpeniletissueofedratmodel
AT yimingadilijiang ab097theexpressionofkallikreinkininsysteminpeniletissueofedratmodel