Cargando…

RAGE deficiency does not affect non-alcoholic steatohepatitis and atherosclerosis in Western type diet-fed Ldlr(−/−) mice

Non-alcoholic fatty liver disease is a spectrum of liver diseases ranging from steatosis only to non-alcoholic steatohepatitis (NASH). The latter is characterized by hepatic inflammation, which increases the risk of cardiovascular disease. It is poorly understood which factors contribute to the onse...

Descripción completa

Detalles Bibliográficos
Autores principales: Bijnen, Mitchell, Beelen, Nicky, Wetzels, Suzan, Gaar, José van de, Vroomen, Maria, Wijnands, Erwin, Scheijen, Jean L., van de Waarenburg, Marjo P. H, Gijbels, Marion J., Cleutjens, Jack P., Biessen, Erik A. L., Stehouwer, Coen D. A., Schalkwijk, Casper G., Wouters, Kristiaan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6189204/
https://www.ncbi.nlm.nih.gov/pubmed/30323247
http://dx.doi.org/10.1038/s41598-018-33661-y
_version_ 1783363315308691456
author Bijnen, Mitchell
Beelen, Nicky
Wetzels, Suzan
Gaar, José van de
Vroomen, Maria
Wijnands, Erwin
Scheijen, Jean L.
van de Waarenburg, Marjo P. H
Gijbels, Marion J.
Cleutjens, Jack P.
Biessen, Erik A. L.
Stehouwer, Coen D. A.
Schalkwijk, Casper G.
Wouters, Kristiaan
author_facet Bijnen, Mitchell
Beelen, Nicky
Wetzels, Suzan
Gaar, José van de
Vroomen, Maria
Wijnands, Erwin
Scheijen, Jean L.
van de Waarenburg, Marjo P. H
Gijbels, Marion J.
Cleutjens, Jack P.
Biessen, Erik A. L.
Stehouwer, Coen D. A.
Schalkwijk, Casper G.
Wouters, Kristiaan
author_sort Bijnen, Mitchell
collection PubMed
description Non-alcoholic fatty liver disease is a spectrum of liver diseases ranging from steatosis only to non-alcoholic steatohepatitis (NASH). The latter is characterized by hepatic inflammation, which increases the risk of cardiovascular disease. It is poorly understood which factors contribute to the onset of hepatic inflammation characterizing the progression from steatosis to NASH. Previously, we demonstrated increased advanced glycation endproducts (AGEs) in the livers of NASH patients. We hypothesise that AGEs play a key role in NASH development by activating their proinflammatory receptor, RAGE. RAGE-deficient mice and wildtype littermates, both on Ldlr(−/−) background, were fed a Western type diet (WTD) for 3 or 12 weeks. Flow cytometry, histology, gene expression and AGE measurements were performed to evaluate the effects of RAGE deficiency. RAGE-deficient mice displayed reduced weight gain and visceral fat expansion compared to control mice. No difference in adipose tissue inflammation was observed between groups. RAGE deficiency did not affect WTD-induced monocytosis, circulating lipids or hepatic steatosis. WTD-induced hepatic neutrophil and macrophage accumulation and atherosclerotic plaque development was comparable between control and RAGE-deficient mice. No difference in AGE levels was observed. RAGE does not seem to play a major role in the development of NASH or atherosclerosis in a hyperlipidemic mouse model.
format Online
Article
Text
id pubmed-6189204
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-61892042018-10-22 RAGE deficiency does not affect non-alcoholic steatohepatitis and atherosclerosis in Western type diet-fed Ldlr(−/−) mice Bijnen, Mitchell Beelen, Nicky Wetzels, Suzan Gaar, José van de Vroomen, Maria Wijnands, Erwin Scheijen, Jean L. van de Waarenburg, Marjo P. H Gijbels, Marion J. Cleutjens, Jack P. Biessen, Erik A. L. Stehouwer, Coen D. A. Schalkwijk, Casper G. Wouters, Kristiaan Sci Rep Article Non-alcoholic fatty liver disease is a spectrum of liver diseases ranging from steatosis only to non-alcoholic steatohepatitis (NASH). The latter is characterized by hepatic inflammation, which increases the risk of cardiovascular disease. It is poorly understood which factors contribute to the onset of hepatic inflammation characterizing the progression from steatosis to NASH. Previously, we demonstrated increased advanced glycation endproducts (AGEs) in the livers of NASH patients. We hypothesise that AGEs play a key role in NASH development by activating their proinflammatory receptor, RAGE. RAGE-deficient mice and wildtype littermates, both on Ldlr(−/−) background, were fed a Western type diet (WTD) for 3 or 12 weeks. Flow cytometry, histology, gene expression and AGE measurements were performed to evaluate the effects of RAGE deficiency. RAGE-deficient mice displayed reduced weight gain and visceral fat expansion compared to control mice. No difference in adipose tissue inflammation was observed between groups. RAGE deficiency did not affect WTD-induced monocytosis, circulating lipids or hepatic steatosis. WTD-induced hepatic neutrophil and macrophage accumulation and atherosclerotic plaque development was comparable between control and RAGE-deficient mice. No difference in AGE levels was observed. RAGE does not seem to play a major role in the development of NASH or atherosclerosis in a hyperlipidemic mouse model. Nature Publishing Group UK 2018-10-15 /pmc/articles/PMC6189204/ /pubmed/30323247 http://dx.doi.org/10.1038/s41598-018-33661-y Text en © The Author(s) 2018 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
spellingShingle Article
Bijnen, Mitchell
Beelen, Nicky
Wetzels, Suzan
Gaar, José van de
Vroomen, Maria
Wijnands, Erwin
Scheijen, Jean L.
van de Waarenburg, Marjo P. H
Gijbels, Marion J.
Cleutjens, Jack P.
Biessen, Erik A. L.
Stehouwer, Coen D. A.
Schalkwijk, Casper G.
Wouters, Kristiaan
RAGE deficiency does not affect non-alcoholic steatohepatitis and atherosclerosis in Western type diet-fed Ldlr(−/−) mice
title RAGE deficiency does not affect non-alcoholic steatohepatitis and atherosclerosis in Western type diet-fed Ldlr(−/−) mice
title_full RAGE deficiency does not affect non-alcoholic steatohepatitis and atherosclerosis in Western type diet-fed Ldlr(−/−) mice
title_fullStr RAGE deficiency does not affect non-alcoholic steatohepatitis and atherosclerosis in Western type diet-fed Ldlr(−/−) mice
title_full_unstemmed RAGE deficiency does not affect non-alcoholic steatohepatitis and atherosclerosis in Western type diet-fed Ldlr(−/−) mice
title_short RAGE deficiency does not affect non-alcoholic steatohepatitis and atherosclerosis in Western type diet-fed Ldlr(−/−) mice
title_sort rage deficiency does not affect non-alcoholic steatohepatitis and atherosclerosis in western type diet-fed ldlr(−/−) mice
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6189204/
https://www.ncbi.nlm.nih.gov/pubmed/30323247
http://dx.doi.org/10.1038/s41598-018-33661-y
work_keys_str_mv AT bijnenmitchell ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT beelennicky ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT wetzelssuzan ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT gaarjosevande ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT vroomenmaria ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT wijnandserwin ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT scheijenjeanl ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT vandewaarenburgmarjoph ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT gijbelsmarionj ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT cleutjensjackp ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT biessenerikal ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT stehouwercoenda ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT schalkwijkcasperg ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice
AT wouterskristiaan ragedeficiencydoesnotaffectnonalcoholicsteatohepatitisandatherosclerosisinwesterntypedietfedldlrmice