Cargando…
Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate
Background: Metformin, an oral anti-hyperglycemic drug which inhibits mitochondrial complex I and oxidative phosphorylation has been reported to correlate with improved outcomes in head and neck squamous cell carcinoma (HNSCC) and other cancers. This effect is postulated to occur through disruption...
Autores principales: | , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6193523/ https://www.ncbi.nlm.nih.gov/pubmed/30364350 http://dx.doi.org/10.3389/fonc.2018.00436 |
_version_ | 1783364076538167296 |
---|---|
author | Curry, Joseph M. Johnson, Jennifer Mollaee, Mehri Tassone, Patrick Amin, Dev Knops, Alexander Whitaker-Menezes, Diana Mahoney, My G. South, Andrew Rodeck, Ulrich Zhan, Tingting Harshyne, Larry Philp, Nancy Luginbuhl, Adam Cognetti, David Tuluc, Madalina Martinez-Outschoorn, Ubaldo |
author_facet | Curry, Joseph M. Johnson, Jennifer Mollaee, Mehri Tassone, Patrick Amin, Dev Knops, Alexander Whitaker-Menezes, Diana Mahoney, My G. South, Andrew Rodeck, Ulrich Zhan, Tingting Harshyne, Larry Philp, Nancy Luginbuhl, Adam Cognetti, David Tuluc, Madalina Martinez-Outschoorn, Ubaldo |
author_sort | Curry, Joseph M. |
collection | PubMed |
description | Background: Metformin, an oral anti-hyperglycemic drug which inhibits mitochondrial complex I and oxidative phosphorylation has been reported to correlate with improved outcomes in head and neck squamous cell carcinoma (HNSCC) and other cancers. This effect is postulated to occur through disruption of tumor-driven metabolic and immune dysregulation in the tumor microenvironment (TME). We report new findings on the impact of metformin on the tumor and immune elements of the TME from a clinical trial of metformin in HNSCC. Methods: Human papilloma virus—(HPV–) tobacco+ mucosal HNSCC samples (n = 12) were compared to HPV+ oropharyngeal squamous cell carcinoma (OPSCC) samples (n = 17) from patients enrolled in a clinical trial. Apoptosis in tumor samples pre- and post-treatment with metformin was compared by deoxynucleotidyl transferase dUTP nick end labeling (TUNEL) assay. Metastatic lymph nodes with extra-capsular extension (ECE) in metformin-treated patients (n = 7) were compared to archival lymph node samples with ECE (n = 11) for differences in immune markers quantified by digital image analysis using co-localization and nuclear algorithms (PD-L1, FoxP3, CD163, CD8). Results: HPV–, tobacco + HNSCC (mean Δ 13.7/high power field) specimens had a significantly higher increase in apoptosis compared to HPV+ OPSCC specimens (mean Δ 5.7/high power field) (p < 0.001). Analysis of the stroma at the invasive front in ECE nodal specimens from both HPV—HNSCC and HPV+ OPSCC metformin treated specimens showed increased CD8+ effector T cell infiltrate (mean 22.8%) compared to archival specimens (mean 10.7%) (p = 0.006). Similarly, metformin treated specimens showed an increased FoxP3+ regulatory T cell infiltrate (mean 9%) compared to non-treated archival specimens (mean 5%) (p = 0.019). Conclusions: This study presents novel data demonstrating that metformin differentially impacts HNSCC subtypes with greater apoptosis in HPV—HNSCC compared to HPV+ OPSCC. Moreover, we present the first in vivo human evidence that metformin may also trigger increased CD8+ Teff and FoxP3+ Tregs in the TME, suggesting an immunomodulatory effect in HNSCC. Further research is necessary to assess the effect of metformin on the TME of HNSCC. |
format | Online Article Text |
id | pubmed-6193523 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-61935232018-10-25 Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate Curry, Joseph M. Johnson, Jennifer Mollaee, Mehri Tassone, Patrick Amin, Dev Knops, Alexander Whitaker-Menezes, Diana Mahoney, My G. South, Andrew Rodeck, Ulrich Zhan, Tingting Harshyne, Larry Philp, Nancy Luginbuhl, Adam Cognetti, David Tuluc, Madalina Martinez-Outschoorn, Ubaldo Front Oncol Oncology Background: Metformin, an oral anti-hyperglycemic drug which inhibits mitochondrial complex I and oxidative phosphorylation has been reported to correlate with improved outcomes in head and neck squamous cell carcinoma (HNSCC) and other cancers. This effect is postulated to occur through disruption of tumor-driven metabolic and immune dysregulation in the tumor microenvironment (TME). We report new findings on the impact of metformin on the tumor and immune elements of the TME from a clinical trial of metformin in HNSCC. Methods: Human papilloma virus—(HPV–) tobacco+ mucosal HNSCC samples (n = 12) were compared to HPV+ oropharyngeal squamous cell carcinoma (OPSCC) samples (n = 17) from patients enrolled in a clinical trial. Apoptosis in tumor samples pre- and post-treatment with metformin was compared by deoxynucleotidyl transferase dUTP nick end labeling (TUNEL) assay. Metastatic lymph nodes with extra-capsular extension (ECE) in metformin-treated patients (n = 7) were compared to archival lymph node samples with ECE (n = 11) for differences in immune markers quantified by digital image analysis using co-localization and nuclear algorithms (PD-L1, FoxP3, CD163, CD8). Results: HPV–, tobacco + HNSCC (mean Δ 13.7/high power field) specimens had a significantly higher increase in apoptosis compared to HPV+ OPSCC specimens (mean Δ 5.7/high power field) (p < 0.001). Analysis of the stroma at the invasive front in ECE nodal specimens from both HPV—HNSCC and HPV+ OPSCC metformin treated specimens showed increased CD8+ effector T cell infiltrate (mean 22.8%) compared to archival specimens (mean 10.7%) (p = 0.006). Similarly, metformin treated specimens showed an increased FoxP3+ regulatory T cell infiltrate (mean 9%) compared to non-treated archival specimens (mean 5%) (p = 0.019). Conclusions: This study presents novel data demonstrating that metformin differentially impacts HNSCC subtypes with greater apoptosis in HPV—HNSCC compared to HPV+ OPSCC. Moreover, we present the first in vivo human evidence that metformin may also trigger increased CD8+ Teff and FoxP3+ Tregs in the TME, suggesting an immunomodulatory effect in HNSCC. Further research is necessary to assess the effect of metformin on the TME of HNSCC. Frontiers Media S.A. 2018-10-11 /pmc/articles/PMC6193523/ /pubmed/30364350 http://dx.doi.org/10.3389/fonc.2018.00436 Text en Copyright © 2018 Curry, Johnson, Mollaee, Tassone, Amin, Knops, Whitaker-Menezes, Mahoney, South, Rodeck, Zhan, Harshyne, Philp, Luginbuhl, Cognetti, Tuluc and Martinez-Outschoorn. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Oncology Curry, Joseph M. Johnson, Jennifer Mollaee, Mehri Tassone, Patrick Amin, Dev Knops, Alexander Whitaker-Menezes, Diana Mahoney, My G. South, Andrew Rodeck, Ulrich Zhan, Tingting Harshyne, Larry Philp, Nancy Luginbuhl, Adam Cognetti, David Tuluc, Madalina Martinez-Outschoorn, Ubaldo Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate |
title | Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate |
title_full | Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate |
title_fullStr | Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate |
title_full_unstemmed | Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate |
title_short | Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate |
title_sort | metformin clinical trial in hpv+ and hpv– head and neck squamous cell carcinoma: impact on cancer cell apoptosis and immune infiltrate |
topic | Oncology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6193523/ https://www.ncbi.nlm.nih.gov/pubmed/30364350 http://dx.doi.org/10.3389/fonc.2018.00436 |
work_keys_str_mv | AT curryjosephm metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT johnsonjennifer metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT mollaeemehri metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT tassonepatrick metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT amindev metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT knopsalexander metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT whitakermenezesdiana metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT mahoneymyg metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT southandrew metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT rodeckulrich metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT zhantingting metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT harshynelarry metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT philpnancy metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT luginbuhladam metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT cognettidavid metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT tulucmadalina metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate AT martinezoutschoornubaldo metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate |