Cargando…

Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate

Background: Metformin, an oral anti-hyperglycemic drug which inhibits mitochondrial complex I and oxidative phosphorylation has been reported to correlate with improved outcomes in head and neck squamous cell carcinoma (HNSCC) and other cancers. This effect is postulated to occur through disruption...

Descripción completa

Detalles Bibliográficos
Autores principales: Curry, Joseph M., Johnson, Jennifer, Mollaee, Mehri, Tassone, Patrick, Amin, Dev, Knops, Alexander, Whitaker-Menezes, Diana, Mahoney, My G., South, Andrew, Rodeck, Ulrich, Zhan, Tingting, Harshyne, Larry, Philp, Nancy, Luginbuhl, Adam, Cognetti, David, Tuluc, Madalina, Martinez-Outschoorn, Ubaldo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6193523/
https://www.ncbi.nlm.nih.gov/pubmed/30364350
http://dx.doi.org/10.3389/fonc.2018.00436
_version_ 1783364076538167296
author Curry, Joseph M.
Johnson, Jennifer
Mollaee, Mehri
Tassone, Patrick
Amin, Dev
Knops, Alexander
Whitaker-Menezes, Diana
Mahoney, My G.
South, Andrew
Rodeck, Ulrich
Zhan, Tingting
Harshyne, Larry
Philp, Nancy
Luginbuhl, Adam
Cognetti, David
Tuluc, Madalina
Martinez-Outschoorn, Ubaldo
author_facet Curry, Joseph M.
Johnson, Jennifer
Mollaee, Mehri
Tassone, Patrick
Amin, Dev
Knops, Alexander
Whitaker-Menezes, Diana
Mahoney, My G.
South, Andrew
Rodeck, Ulrich
Zhan, Tingting
Harshyne, Larry
Philp, Nancy
Luginbuhl, Adam
Cognetti, David
Tuluc, Madalina
Martinez-Outschoorn, Ubaldo
author_sort Curry, Joseph M.
collection PubMed
description Background: Metformin, an oral anti-hyperglycemic drug which inhibits mitochondrial complex I and oxidative phosphorylation has been reported to correlate with improved outcomes in head and neck squamous cell carcinoma (HNSCC) and other cancers. This effect is postulated to occur through disruption of tumor-driven metabolic and immune dysregulation in the tumor microenvironment (TME). We report new findings on the impact of metformin on the tumor and immune elements of the TME from a clinical trial of metformin in HNSCC. Methods: Human papilloma virus—(HPV–) tobacco+ mucosal HNSCC samples (n = 12) were compared to HPV+ oropharyngeal squamous cell carcinoma (OPSCC) samples (n = 17) from patients enrolled in a clinical trial. Apoptosis in tumor samples pre- and post-treatment with metformin was compared by deoxynucleotidyl transferase dUTP nick end labeling (TUNEL) assay. Metastatic lymph nodes with extra-capsular extension (ECE) in metformin-treated patients (n = 7) were compared to archival lymph node samples with ECE (n = 11) for differences in immune markers quantified by digital image analysis using co-localization and nuclear algorithms (PD-L1, FoxP3, CD163, CD8). Results: HPV–, tobacco + HNSCC (mean Δ 13.7/high power field) specimens had a significantly higher increase in apoptosis compared to HPV+ OPSCC specimens (mean Δ 5.7/high power field) (p < 0.001). Analysis of the stroma at the invasive front in ECE nodal specimens from both HPV—HNSCC and HPV+ OPSCC metformin treated specimens showed increased CD8+ effector T cell infiltrate (mean 22.8%) compared to archival specimens (mean 10.7%) (p = 0.006). Similarly, metformin treated specimens showed an increased FoxP3+ regulatory T cell infiltrate (mean 9%) compared to non-treated archival specimens (mean 5%) (p = 0.019). Conclusions: This study presents novel data demonstrating that metformin differentially impacts HNSCC subtypes with greater apoptosis in HPV—HNSCC compared to HPV+ OPSCC. Moreover, we present the first in vivo human evidence that metformin may also trigger increased CD8+ Teff and FoxP3+ Tregs in the TME, suggesting an immunomodulatory effect in HNSCC. Further research is necessary to assess the effect of metformin on the TME of HNSCC.
format Online
Article
Text
id pubmed-6193523
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-61935232018-10-25 Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate Curry, Joseph M. Johnson, Jennifer Mollaee, Mehri Tassone, Patrick Amin, Dev Knops, Alexander Whitaker-Menezes, Diana Mahoney, My G. South, Andrew Rodeck, Ulrich Zhan, Tingting Harshyne, Larry Philp, Nancy Luginbuhl, Adam Cognetti, David Tuluc, Madalina Martinez-Outschoorn, Ubaldo Front Oncol Oncology Background: Metformin, an oral anti-hyperglycemic drug which inhibits mitochondrial complex I and oxidative phosphorylation has been reported to correlate with improved outcomes in head and neck squamous cell carcinoma (HNSCC) and other cancers. This effect is postulated to occur through disruption of tumor-driven metabolic and immune dysregulation in the tumor microenvironment (TME). We report new findings on the impact of metformin on the tumor and immune elements of the TME from a clinical trial of metformin in HNSCC. Methods: Human papilloma virus—(HPV–) tobacco+ mucosal HNSCC samples (n = 12) were compared to HPV+ oropharyngeal squamous cell carcinoma (OPSCC) samples (n = 17) from patients enrolled in a clinical trial. Apoptosis in tumor samples pre- and post-treatment with metformin was compared by deoxynucleotidyl transferase dUTP nick end labeling (TUNEL) assay. Metastatic lymph nodes with extra-capsular extension (ECE) in metformin-treated patients (n = 7) were compared to archival lymph node samples with ECE (n = 11) for differences in immune markers quantified by digital image analysis using co-localization and nuclear algorithms (PD-L1, FoxP3, CD163, CD8). Results: HPV–, tobacco + HNSCC (mean Δ 13.7/high power field) specimens had a significantly higher increase in apoptosis compared to HPV+ OPSCC specimens (mean Δ 5.7/high power field) (p < 0.001). Analysis of the stroma at the invasive front in ECE nodal specimens from both HPV—HNSCC and HPV+ OPSCC metformin treated specimens showed increased CD8+ effector T cell infiltrate (mean 22.8%) compared to archival specimens (mean 10.7%) (p = 0.006). Similarly, metformin treated specimens showed an increased FoxP3+ regulatory T cell infiltrate (mean 9%) compared to non-treated archival specimens (mean 5%) (p = 0.019). Conclusions: This study presents novel data demonstrating that metformin differentially impacts HNSCC subtypes with greater apoptosis in HPV—HNSCC compared to HPV+ OPSCC. Moreover, we present the first in vivo human evidence that metformin may also trigger increased CD8+ Teff and FoxP3+ Tregs in the TME, suggesting an immunomodulatory effect in HNSCC. Further research is necessary to assess the effect of metformin on the TME of HNSCC. Frontiers Media S.A. 2018-10-11 /pmc/articles/PMC6193523/ /pubmed/30364350 http://dx.doi.org/10.3389/fonc.2018.00436 Text en Copyright © 2018 Curry, Johnson, Mollaee, Tassone, Amin, Knops, Whitaker-Menezes, Mahoney, South, Rodeck, Zhan, Harshyne, Philp, Luginbuhl, Cognetti, Tuluc and Martinez-Outschoorn. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Oncology
Curry, Joseph M.
Johnson, Jennifer
Mollaee, Mehri
Tassone, Patrick
Amin, Dev
Knops, Alexander
Whitaker-Menezes, Diana
Mahoney, My G.
South, Andrew
Rodeck, Ulrich
Zhan, Tingting
Harshyne, Larry
Philp, Nancy
Luginbuhl, Adam
Cognetti, David
Tuluc, Madalina
Martinez-Outschoorn, Ubaldo
Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate
title Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate
title_full Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate
title_fullStr Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate
title_full_unstemmed Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate
title_short Metformin Clinical Trial in HPV+ and HPV– Head and Neck Squamous Cell Carcinoma: Impact on Cancer Cell Apoptosis and Immune Infiltrate
title_sort metformin clinical trial in hpv+ and hpv– head and neck squamous cell carcinoma: impact on cancer cell apoptosis and immune infiltrate
topic Oncology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6193523/
https://www.ncbi.nlm.nih.gov/pubmed/30364350
http://dx.doi.org/10.3389/fonc.2018.00436
work_keys_str_mv AT curryjosephm metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT johnsonjennifer metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT mollaeemehri metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT tassonepatrick metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT amindev metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT knopsalexander metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT whitakermenezesdiana metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT mahoneymyg metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT southandrew metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT rodeckulrich metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT zhantingting metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT harshynelarry metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT philpnancy metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT luginbuhladam metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT cognettidavid metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT tulucmadalina metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate
AT martinezoutschoornubaldo metforminclinicaltrialinhpvandhpvheadandnecksquamouscellcarcinomaimpactoncancercellapoptosisandimmuneinfiltrate