Cargando…

Cell-type specific RNA-Seq reveals novel roles and regulatory programs for terminally differentiated Dictyostelium cells

BACKGROUND: A major hallmark of multicellular evolution is increasing complexity by the evolution of new specialized cell types. During Dictyostelid evolution novel specialization occurred within taxon group 4. We here aim to retrace the nature and ancestry of the novel “cup” cells by comparing thei...

Descripción completa

Detalles Bibliográficos
Autores principales: Kin, Koryu, Forbes, Gillian, Cassidy, Andrew, Schaap, Pauline
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6198379/
https://www.ncbi.nlm.nih.gov/pubmed/30348074
http://dx.doi.org/10.1186/s12864-018-5146-3
_version_ 1783364953586008064
author Kin, Koryu
Forbes, Gillian
Cassidy, Andrew
Schaap, Pauline
author_facet Kin, Koryu
Forbes, Gillian
Cassidy, Andrew
Schaap, Pauline
author_sort Kin, Koryu
collection PubMed
description BACKGROUND: A major hallmark of multicellular evolution is increasing complexity by the evolution of new specialized cell types. During Dictyostelid evolution novel specialization occurred within taxon group 4. We here aim to retrace the nature and ancestry of the novel “cup” cells by comparing their transcriptome to that of other cell types. RESULTS: RNA-Seq was performed on purified mature spore, stalk and cup cells and on vegetative amoebas. Clustering and phylogenetic analyses showed that cup cells were most similar to stalk cells, suggesting that they share a common ancestor. The affinity between cup and stalk cells was also evident from promoter-reporter studies of newly identified cell-type genes, which revealed late expression in cups of many stalk genes. However, GO enrichment analysis reveal the unexpected prominence of GTPase mediated signalling in cup cells, in contrast to enrichment of autophagy and cell wall synthesis related transcripts in stalk cells. Combining the cell type RNA-Seq data with developmental expression profiles revealed complex expression dynamics in each cell type as well as genes exclusively expressed during terminal differentiation. Most notable were nine related hssA-like genes that were highly and exclusively expressed in cup cells. CONCLUSIONS: This study reveals the unique transcriptomes of the mature cup, stalk and spore cells of D. discoideum and provides insight into the ancestry of cup cells and roles in signalling that were not previously realized. The data presented in this study will serve as an important resource for future studies into the regulation and evolution of cell type specialization. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12864-018-5146-3) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6198379
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-61983792018-10-31 Cell-type specific RNA-Seq reveals novel roles and regulatory programs for terminally differentiated Dictyostelium cells Kin, Koryu Forbes, Gillian Cassidy, Andrew Schaap, Pauline BMC Genomics Research Article BACKGROUND: A major hallmark of multicellular evolution is increasing complexity by the evolution of new specialized cell types. During Dictyostelid evolution novel specialization occurred within taxon group 4. We here aim to retrace the nature and ancestry of the novel “cup” cells by comparing their transcriptome to that of other cell types. RESULTS: RNA-Seq was performed on purified mature spore, stalk and cup cells and on vegetative amoebas. Clustering and phylogenetic analyses showed that cup cells were most similar to stalk cells, suggesting that they share a common ancestor. The affinity between cup and stalk cells was also evident from promoter-reporter studies of newly identified cell-type genes, which revealed late expression in cups of many stalk genes. However, GO enrichment analysis reveal the unexpected prominence of GTPase mediated signalling in cup cells, in contrast to enrichment of autophagy and cell wall synthesis related transcripts in stalk cells. Combining the cell type RNA-Seq data with developmental expression profiles revealed complex expression dynamics in each cell type as well as genes exclusively expressed during terminal differentiation. Most notable were nine related hssA-like genes that were highly and exclusively expressed in cup cells. CONCLUSIONS: This study reveals the unique transcriptomes of the mature cup, stalk and spore cells of D. discoideum and provides insight into the ancestry of cup cells and roles in signalling that were not previously realized. The data presented in this study will serve as an important resource for future studies into the regulation and evolution of cell type specialization. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12864-018-5146-3) contains supplementary material, which is available to authorized users. BioMed Central 2018-10-22 /pmc/articles/PMC6198379/ /pubmed/30348074 http://dx.doi.org/10.1186/s12864-018-5146-3 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Kin, Koryu
Forbes, Gillian
Cassidy, Andrew
Schaap, Pauline
Cell-type specific RNA-Seq reveals novel roles and regulatory programs for terminally differentiated Dictyostelium cells
title Cell-type specific RNA-Seq reveals novel roles and regulatory programs for terminally differentiated Dictyostelium cells
title_full Cell-type specific RNA-Seq reveals novel roles and regulatory programs for terminally differentiated Dictyostelium cells
title_fullStr Cell-type specific RNA-Seq reveals novel roles and regulatory programs for terminally differentiated Dictyostelium cells
title_full_unstemmed Cell-type specific RNA-Seq reveals novel roles and regulatory programs for terminally differentiated Dictyostelium cells
title_short Cell-type specific RNA-Seq reveals novel roles and regulatory programs for terminally differentiated Dictyostelium cells
title_sort cell-type specific rna-seq reveals novel roles and regulatory programs for terminally differentiated dictyostelium cells
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6198379/
https://www.ncbi.nlm.nih.gov/pubmed/30348074
http://dx.doi.org/10.1186/s12864-018-5146-3
work_keys_str_mv AT kinkoryu celltypespecificrnaseqrevealsnovelrolesandregulatoryprogramsforterminallydifferentiateddictyosteliumcells
AT forbesgillian celltypespecificrnaseqrevealsnovelrolesandregulatoryprogramsforterminallydifferentiateddictyosteliumcells
AT cassidyandrew celltypespecificrnaseqrevealsnovelrolesandregulatoryprogramsforterminallydifferentiateddictyosteliumcells
AT schaappauline celltypespecificrnaseqrevealsnovelrolesandregulatoryprogramsforterminallydifferentiateddictyosteliumcells